![Western Blot: LONP1 Antibody [NBP2-76504] - Western blot analysis using Anti-LONP1 antibody NBP2-76504 (A) shows similar pattern to independent antibody NPB1-81734 (B).](http://images.novusbio.com/fullsize/LONP1-Antibody-Western-Blot-NBP2-76504-img0001.jpg "Western Blot: LONP1 Antibody [NBP2-76504] - Western blot analysis using Anti-LONP1 antibody NBP2-76504 (A) shows similar pattern to independent antibody NPB1-81734 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTIRDIIALNPLYRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDA |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LONP1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/16321.jpg)
![Knockout Validated STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Knockout_Validated_21968.jpg)
![Immunocytochemistry STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Immunocytochemistry__Immunofluorescence_17603.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LONP1 Antibody (NBP2-76504)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LONP1 |
![Immunocytochemistry/Immunofluorescence: LONP1 Antibody [NBP2-76504] - Staining of human cell line U-251 MG shows localization to nucleus & mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/LONP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-76504-img0002.jpg "Immunocytochemistry/Immunofluorescence: LONP1 Antibody [NBP2-76504] - Staining of human cell line U-251 MG shows localization to nucleus & mitochondria. Antibody staining is shown in green.")
![Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Western_Blot_5176.jpg)
![Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16339.jpg)
![Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Chromatin_Immunoprecipitation_11246.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Simple_Western_21000.jpg)
![Western Blot STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Western_Blot_5993.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Knockout_Validated_21531.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")