![Western Blot: CLPP Antibody [NBP1-89557] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-CLPP antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/CLPP-Antibody-Western-Blot-NBP1-89557-img0011.jpg "Western Blot: CLPP Antibody [NBP1-89557] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-CLPP antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CLPP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC-Frozen was reported in scientific literature (PMID: 30877431). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CLPP Antibody (NBP1-89557)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CLPP |
![Immunocytochemistry/Immunofluorescence: CLPP Antibody [NBP1-89557] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CLPP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89557-img0010.jpg "Immunocytochemistry/Immunofluorescence: CLPP Antibody [NBP1-89557] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CLPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89557-img0015.jpg "Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.")
![Western Blot: CLPP Antibody [NBP1-89557] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/CLPP-Antibody-Western-Blot-NBP1-89557-img0007.jpg "Western Blot: CLPP Antibody [NBP1-89557] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/CLPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89557-img0012.jpg "Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/CLPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89557-img0013.jpg "Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/CLPP-Antibody-Immunohistochemistry-Paraffin-NBP1-89557-img0014.jpg "Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")