![Western Blot: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Western blot analysis of extracts of various cell lines, using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/HSP10-EPF-Antibody-0H0X6-Western-Blot-NBP3-16604-img0006.jpg "Western Blot: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Western blot analysis of extracts of various cell lines, using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 0H0X6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human HSP10/EPF (P61604). GSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | HSPE1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 11 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HSP10/EPF Antibody (NBP3-16604)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HSPE1 |
![Immunocytochemistry/Immunofluorescence: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunofluorescence analysis of NIH-3T3 cells using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/HSP10-EPF-Antibody-0H0X6-Immunocytochemistry-Immunofluorescence-NBP3-16604-img0005.jpg "Immunocytochemistry/Immunofluorescence: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunofluorescence analysis of NIH-3T3 cells using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded mouse kidney using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HSP10-EPF-Antibody-0H0X6-Immunohistochemistry-Paraffin-NBP3-16604-img0004.jpg "Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded mouse kidney using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded rat brain using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HSP10-EPF-Antibody-0H0X6-Immunohistochemistry-Paraffin-NBP3-16604-img0001.jpg "Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded rat brain using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded human colon using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HSP10-EPF-Antibody-0H0X6-Immunohistochemistry-Paraffin-NBP3-16604-img0002.jpg "Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded human colon using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded human placenta using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HSP10-EPF-Antibody-0H0X6-Immunohistochemistry-Paraffin-NBP3-16604-img0003.jpg "Immunohistochemistry-Paraffin: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry of paraffin-embedded human placenta using HSPE1/HSP10/HSP10/EPF Rabbit mAb (NBP3-16604) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16604_rabbit-hsp10-epf-mab-0h0x6-5220251265357.jpg "Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16604_rabbit-hsp10-epf-mab-0h0x6-5220251242562.jpg "Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16604_rabbit-hsp10-epf-mab-0h0x6-52202511361243.jpg "Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16604_rabbit-hsp10-epf-mab-0h0x6-52202511392222.jpg "Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [NBP3-16604] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [HSP10/EPF] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16604_rabbit-hsp10-epf-mab-0h0x6-52202517162362.jpg "Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [HSP10/EPF] - Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [HSP10/EPF] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16604_rabbit-hsp10-epf-mab-0h0x6-5220251726050.jpg "Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [HSP10/EPF] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [HSP10/EPF] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16604_rabbit-hsp10-epf-mab-0h0x6-52202517251931.jpg "Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [HSP10/EPF] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [HSP10/EPF] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16604_rabbit-hsp10-epf-mab-0h0x6-52202517284928.jpg "Immunohistochemistry: HSP10/EPF Antibody (0H0X6) [HSP10/EPF] - Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using HSP10/EPF Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")