![Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining in human duodenum and liver tissues using anti-ME2 antibody. Corresponding ME2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ME2-Antibody-Immunohistochemistry-Paraffin-NBP1-89559-img0009.jpg "Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining in human duodenum and liver tissues using anti-ME2 antibody. Corresponding ME2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ME2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 65 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ME2 Antibody (NBP1-89559)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ME2 antibody NBP1-89559 (A) shows similar protein distribution across tissues to independent antibody NBP1-82434 (B).](http://images.novusbio.com/fullsize/ME2-Antibody-Immunohistochemistry-Paraffin-NBP1-89559-img0011.jpg "Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ME2 antibody NBP1-89559 (A) shows similar protein distribution across tissues to independent antibody NBP1-82434 (B).")
![Western Blot: ME2 Antibody [NBP1-89559] - Analysis using Anti-ME2 antibody NBP1-89559 (A) shows similar pattern to independent antibody NBP1-82434 (B).](http://images.novusbio.com/fullsize/ME2-Antibody-Western-Blot-NBP1-89559-img0012.jpg "Western Blot: ME2 Antibody [NBP1-89559] - Analysis using Anti-ME2 antibody NBP1-89559 (A) shows similar pattern to independent antibody NBP1-82434 (B).")
![Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human colon.](http://images.novusbio.com/fullsize/ME2-Antibody-Immunohistochemistry-Paraffin-NBP1-89559-img0015.jpg "Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human colon.")
![Western Blot: ME2 Antibody [NBP1-89559] - Analysis in human cell line Daudi.](http://images.novusbio.com/fullsize/ME2-Antibody-Western-Blot-NBP1-89559-img0010.jpg "Western Blot: ME2 Antibody [NBP1-89559] - Analysis in human cell line Daudi.")
![Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ME2-Antibody-Immunohistochemistry-Paraffin-NBP1-89559-img0006.jpg "Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human duodenum shows high expression.](http://images.novusbio.com/fullsize/ME2-Antibody-Immunohistochemistry-Paraffin-NBP1-89559-img0007.jpg "Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human duodenum shows high expression.")
![Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/ME2-Antibody-Immunohistochemistry-Paraffin-NBP1-89559-img0008.jpg "Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human lymph node.](http://images.novusbio.com/fullsize/ME2-Antibody-Immunohistochemistry-Paraffin-NBP1-89559-img0013.jpg "Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/ME2-Antibody-Immunohistochemistry-Paraffin-NBP1-89559-img0014.jpg "Immunohistochemistry-Paraffin: ME2 Antibody [NBP1-89559] - Staining of human cerebral cortex.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")