![Western Blot: LAP3 Antibody [NBP1-82847] - Analysis using Anti-LAP3 antibody NBP1-82847 (A) shows similar pattern to independent antibody NBP1-82848 (B).](http://images.novusbio.com/fullsize/LAP3-Antibody-Western-Blot-NBP1-82847-img0012.jpg "Western Blot: LAP3 Antibody [NBP1-82847] - Analysis using Anti-LAP3 antibody NBP1-82847 (A) shows similar pattern to independent antibody NBP1-82848 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LAP3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LAP3 Antibody (NBP1-82847)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LAP3 |
![Immunocytochemistry/Immunofluorescence: LAP3 Antibody [NBP1-82847] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & midbody.](http://images.novusbio.com/fullsize/LAP3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82847-img0006.jpg "Immunocytochemistry/Immunofluorescence: LAP3 Antibody [NBP1-82847] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & midbody.")
![Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human kidney.](http://images.novusbio.com/fullsize/LAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-82847-img0014.jpg "Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/LAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-82847-img0007.jpg "Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human lymph node shows high expression.](http://images.novusbio.com/fullsize/LAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-82847-img0008.jpg "Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human lymph node shows high expression.")
![Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/LAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-82847-img0009.jpg "Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining in human lymph node and skeletal muscle tissues using anti-LAP3 antibody. Corresponding LAP3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/LAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-82847-img0010.jpg "Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining in human lymph node and skeletal muscle tissues using anti-LAP3 antibody. Corresponding LAP3 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human kidney, lymph node, skeletal muscle and testis using Anti-LAP3 antibody NBP1-82847 (A) shows similar protein distribution across tissues to independent antibody NBP1-82848 (B).](http://images.novusbio.com/fullsize/LAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-82847-img0011.jpg "Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human kidney, lymph node, skeletal muscle and testis using Anti-LAP3 antibody NBP1-82847 (A) shows similar protein distribution across tissues to independent antibody NBP1-82848 (B).")
![Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human testis.](http://images.novusbio.com/fullsize/LAP3-Antibody-Immunohistochemistry-Paraffin-NBP1-82847-img0013.jpg "Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human testis.")
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")