![Immunocytochemistry/Immunofluorescence: Als2 Antibody [NBP2-14284] - Over-expression of Alsin or Rab5 blocks caspase-3/7 activation.(A) HeLa cells transiently expressing empty vector, Alsin, or Rab5 were incubated in the presence of 500 uM H2O2 and 5 uM CellEvent caspase-3/7 green detection reagent at 37 degrees C for 2 hr. Nucleus was stained with DAPI (blue). Images were acquired by confocal microscopy. Caspase-activated cells displayed green signals, while non-activated cells (PBS control) showed no signal. Percent of cells with positive signals were quantified in (B), n = 50. Image collected and cropped by CiteAb from the following publication (elifesciences.org/articles/32282), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Als2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14284-img0006.jpg "Immunocytochemistry/Immunofluorescence: Als2 Antibody [NBP2-14284] - Over-expression of Alsin or Rab5 blocks caspase-3/7 activation.(A) HeLa cells transiently expressing empty vector, Alsin, or Rab5 were incubated in the presence of 500 uM H2O2 and 5 uM CellEvent caspase-3/7 green detection reagent at 37 degrees C for 2 hr. Nucleus was stained with DAPI (blue). Images were acquired by confocal microscopy. Caspase-activated cells displayed green signals, while non-activated cells (PBS control) showed no signal. Percent of cells with positive signals were quantified in (B), n = 50. Image collected and cropped by CiteAb from the following publication (elifesciences.org/articles/32282), licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD |
| Predicted Species | Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALS2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP2-14284 | Applications | Species |
|---|---|---|
| Hsu F, Spannl S, Ferguson C et al. Rab5 and Alsin regulate stress-activated cytoprotective signaling on mitochondria. bioRxiv. [PMID: 29469808] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
|
Amyotrophic Lateral Sclerosis Infographic Amyotrophic lateral sclerosis is a neurological disease which impacts motor neurons that are involved in muscle movement throughout the body. The progressive degeneration of neurons causes weakened muscles and can lead to paralysis. There is no cure f... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ALS2 |
![Immunohistochemistry-Paraffin: Als2 Antibody [NBP2-14284] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/Als2-Antibody-Immunohistochemistry-Paraffin-NBP2-14284-img0004.jpg "Immunohistochemistry-Paraffin: Als2 Antibody [NBP2-14284] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunocytochemistry/Immunofluorescence: Als2 Antibody [NBP2-14284] - Staining of human cell line U-2 OS shows localization to intermediate filaments. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Als2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14284-img0005.jpg "Immunocytochemistry/Immunofluorescence: Als2 Antibody [NBP2-14284] - Staining of human cell line U-2 OS shows localization to intermediate filaments. Antibody staining is shown in green.")
![Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] - Over-expression of Alsin or Rab5 blocks caspase-3/7 activation.(A) HeLa cells transiently expressing empty vector, Alsin, or Rab5 were incubated in the presence of 500 μM H2O2 & 5 μM CellEvent caspase-3/7 green detection reagent at 37°C for 2 hr. Nucleus was stained with DAPI (blue). Images were acquired by confocal microscopy. Caspase-activated cells displayed green signals, while non-activated cells (PBS control) showed no signal. Percent of cells with positive signals were quantified in (B), n = 50. Error bars represent SEMs. Scale bars, 10 μm.10.7554/eLife.32282.045Figure 10—figure supplement 2—source data 1.Numerical data corresponding to the bar graphs presented in Figure 10—figure supplement 2B.Numerical data corresponding to the bar graphs presented in Figure 10—figure supplement 2B. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29469808), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-14284_rabbit-polyclonal-als2-antibody-310202416113542.jpg "Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] - Over-expression of Alsin or Rab5 blocks caspase-3/7 activation.(A) HeLa cells transiently expressing empty vector, Alsin, or Rab5 were incubated in the presence of 500 μM H2O2 & 5 μM CellEvent caspase-3/7 green detection reagent at 37°C for 2 hr. Nucleus was stained with DAPI (blue). Images were acquired by confocal microscopy. Caspase-activated cells displayed green signals, while non-activated cells (PBS control) showed no signal. Percent of cells with positive signals were quantified in (B), n = 50. Error bars represent SEMs. Scale bars, 10 μm.10.7554/eLife.32282.045Figure 10—figure supplement 2—source data 1.Numerical data corresponding to the bar graphs presented in Figure 10—figure supplement 2B.Numerical data corresponding to the bar graphs presented in Figure 10—figure supplement 2B. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29469808), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] - Validation of the CRISPR/Cas9 Alsin-/- cells in iPSC, NPC & iPSC-sMN.(A) Electrophoresis result of the PCR reaction using primers flanking exon three & within exon 3. Homozygous deletion was confirmed by the absence of a 2.8 kb. (B) Protein lysates from WT KOLF & Alsin-/- iPSC were loaded onto SDS-PAGE & immunoblotted with Alsin antibody. A band detected at ~184 kDa, but absent in Alsin-/-, corresponds to full-length Alsin. (C) WT KOLF, Alsin-/- iPSC, & neuroprogenitor cells (NPC) were immunostained with pluripotency markers Oct4 & Lin28, & neuroprogenitor markers Sox2 & Pax6, respectively. (D–E) WT KOLF & Alsin-/- iPSC-sMN were immunostained with motor neuron markers such as ChAT, HB9, & ISL1, nuclear dye DAPI, & cytoskeletal marker MAP2. (F) WT KOLF & Alsin-/- iPSC-sMN were immunostained with antibodies against Rab5 & Alsin, along with DAPI (nuclear) & phalloidin (actin) stains. Scale bars, 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29469808), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp2-14284_rabbit-polyclonal-als2-antibody-310202416121915.jpg "Immunocytochemistry/ Immunofluorescence: Als2 Antibody [NBP2-14284] - Validation of the CRISPR/Cas9 Alsin-/- cells in iPSC, NPC & iPSC-sMN.(A) Electrophoresis result of the PCR reaction using primers flanking exon three & within exon 3. Homozygous deletion was confirmed by the absence of a 2.8 kb. (B) Protein lysates from WT KOLF & Alsin-/- iPSC were loaded onto SDS-PAGE & immunoblotted with Alsin antibody. A band detected at ~184 kDa, but absent in Alsin-/-, corresponds to full-length Alsin. (C) WT KOLF, Alsin-/- iPSC, & neuroprogenitor cells (NPC) were immunostained with pluripotency markers Oct4 & Lin28, & neuroprogenitor markers Sox2 & Pax6, respectively. (D–E) WT KOLF & Alsin-/- iPSC-sMN were immunostained with motor neuron markers such as ChAT, HB9, & ISL1, nuclear dye DAPI, & cytoskeletal marker MAP2. (F) WT KOLF & Alsin-/- iPSC-sMN were immunostained with antibodies against Rab5 & Alsin, along with DAPI (nuclear) & phalloidin (actin) stains. Scale bars, 10 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29469808), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot ALS Antibody [Unconjugated]](https://images.novusbio.com/images2/ALS_AF1436_Western_Blot_17079.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")