![Western Blot: VAP-B Antibody [NBP1-89112] - Analysis in human cell lines Caco-2 and HEK293 using anti-VAPB antibody. Corresponding VAPB RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.](http://images.novusbio.com/fullsize/VAP-B-Antibody-Western-Blot-NBP1-89112-img0023.jpg "Western Blot: VAP-B Antibody [NBP1-89112] - Analysis in human cell lines Caco-2 and HEK293 using anti-VAPB antibody. Corresponding VAPB RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | VAPB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Use in Immunoprecipitation reported in scientific literature (PMID:32752233). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. VAP-B antibody validated for ICC/IF from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89112 | Applications | Species |
|---|---|---|
| Kim K, Lee YS, Jeong S et al. A Small Molecule, 4-Phenylbutyric Acid, Suppresses HCV Replication via Epigenetically Induced Hepatic Hepcidin Int J Mol Sci 2020-08-01 [PMID: 32752233] (IP, Human) | IP | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IF | Human | 12/11/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for VAP-B Antibody (NBP1-89112)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | VAPB |
![Immunocytochemistry/Immunofluorescence: VAP-B Antibody [NBP1-89112] - Staining of human cell line U-2 OS shows positivity in endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/VAP-B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89112-img0021.jpg "Immunocytochemistry/Immunofluorescence: VAP-B Antibody [NBP1-89112] - Staining of human cell line U-2 OS shows positivity in endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/VAP-B-Antibody-Immunohistochemistry-Paraffin-NBP1-89112-img0019.jpg "Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: VAP-B Antibody [NBP1-89112] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/VAP-B-Antibody-Western-Blot-NBP1-89112-img0007.jpg "Western Blot: VAP-B Antibody [NBP1-89112] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/VAP-B-Antibody-Immunohistochemistry-Paraffin-NBP1-89112-img0016.jpg "Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/VAP-B-Antibody-Immunohistochemistry-Paraffin-NBP1-89112-img0017.jpg "Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/VAP-B-Antibody-Immunohistochemistry-Paraffin-NBP1-89112-img0018.jpg "Immunohistochemistry-Paraffin: VAP-B Antibody [NBP1-89112] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Western Blot ALS Antibody [Unconjugated]](https://images.novusbio.com/images2/ALS_AF1436_Western_Blot_17079.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
