![Western Blot: NIR2 Antibody [NBP2-34132] - TEST](http://images.novusbio.com/fullsize/NIR2-Antibody-Western-Blot-NBP2-34132-img0013.jpg "Western Blot: NIR2 Antibody [NBP2-34132] - TEST")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PKEMTKWNSNDFIDAFASPVEAEGTPEPGAEAAKGIEDGAQAPRDSEGLDGAGELGAEACAVHALFLILHSGNILDSGP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PITPNM1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NIR2 Antibody (NBP2-34132)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: NIR2 Antibody [NBP2-34132] - Staining of human cell line A549 shows positivity in cytoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NIR2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34132-img0006.jpg "Immunocytochemistry/Immunofluorescence: NIR2 Antibody [NBP2-34132] - Staining of human cell line A549 shows positivity in cytoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human Pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/NIR2-Antibody-Immunohistochemistry-Paraffin-NBP2-34132-img0012.jpg "Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human Pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.")
![Western Blot: NIR2 Antibody [NBP2-34132] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/NIR2-Antibody-Western-Blot-NBP2-34132-img0005.jpg "Western Blot: NIR2 Antibody [NBP2-34132] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4")
![Western Blot: NIR2 Antibody [NBP2-34132] - Analysis in human cell line HDLM-2.](http://images.novusbio.com/fullsize/NIR2-Antibody-Western-Blot-NBP2-34132-img0008.jpg "Western Blot: NIR2 Antibody [NBP2-34132] - Analysis in human cell line HDLM-2.")
![Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NIR2-Antibody-Immunohistochemistry-Paraffin-NBP2-34132-img0007.jpg "Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/NIR2-Antibody-Immunohistochemistry-Paraffin-NBP2-34132-img0009.jpg "Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human Fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/NIR2-Antibody-Immunohistochemistry-Paraffin-NBP2-34132-img0010.jpg "Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human Fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human Heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/NIR2-Antibody-Immunohistochemistry-Paraffin-NBP2-34132-img0011.jpg "Immunohistochemistry-Paraffin: NIR2 Antibody [NBP2-34132] - Staining of human Heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.")
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunohistochemistry Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Immunohistochemistry_11019.jpg)
![Western Blot Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Western_Blot_11065.jpg)
![Knockout Validated Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Knockout_Validated_23118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")