![Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.](http://images.novusbio.com/fullsize/SLC2A4RG-Antibody-4C10-Western-Blot-H00056731-M02-img0005.jpg "Western Blot: SLC2A4RG Antibody (4C10) [H00056731-M02] - SLC2A4RG monoclonal antibody (M02), clone 4C10 Analysis of SLC2A4RG expression in HeLa.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 4C10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | SLC2A4RG (NP_064446, 178 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPTASM |
| Specificity | SLC2A4RG - SLC2A4 regulator (4C10) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC2A4RG |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SLC2A4RG Antibody (H00056731-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/SLC2A4RG-Antibody-4C10-Immunocytochemistry-Immunofluorescence-H00056731-M02-img0004.jpg "Immunocytochemistry/Immunofluorescence: SLC2A4RG Antibody (4C10) [H00056731-M02] - Analysis of monoclonal antibody to SLC2A4RG on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Simple Western Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav1_MAB37861_Simple_Western_16683.jpg)
![Western Blot Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav-1_MAB37861_Western_Blot_12193.jpg)
![Immunocytochemistry Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav-1_MAB37861_Immunocytochemistry_12236.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
