![Western Blot: SUZ12 Antibody (1M3V2) [NBP3-16383] - Western blot analysis of extracts of various cell lines, using SUZ12 Rabbit mAb (NBP3-16383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/SUZ12-Antibody-1M3V2-Western-Blot-NBP3-16383-img0001.jpg "Western Blot: SUZ12 Antibody (1M3V2) [NBP3-16383] - Western blot analysis of extracts of various cell lines, using SUZ12 Rabbit mAb (NBP3-16383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IP |
| Clone | 1M3V2 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human SUZ12 (Q15022). MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQI |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | SUZ12 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SUZ12 Antibody (NBP3-16383)Find related products by research area.
|
|
Microglia: pruning shears for homeostatic maintenance in the brain By Jennifer Sokolowski, MD, PhD.Microglia play a critical role in pruning neurons and synapses during homeostatic maintenance in the adult brain.1 A recent study by Ayata et al. (2018) identified regional differe... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUZ12 |
![Western Blot: SUZ12 Antibody (1M3V2) [NBP3-16383] - Western blot analysis of extracts of various cell lines, using SUZ12 Rabbit mAb (NBP3-16383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/SUZ12-Antibody-1M3V2-Western-Blot-NBP3-16383-img0002.jpg "Western Blot: SUZ12 Antibody (1M3V2) [NBP3-16383] - Western blot analysis of extracts of various cell lines, using SUZ12 Rabbit mAb (NBP3-16383) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 30s.")
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images2/EZH2_AF4767_Western_Blot_12571.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240516.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240219.jpg)
![Western Blot EED Antibody [Unconjugated]](https://images.novusbio.com/images2/EED_AF5827_Western_Blot_5862.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")