![Western Blot: SUB1 Antibody [NBP1-82454] - Analysis in human cell line RPMI-8226.](http://images.novusbio.com/fullsize/SUB1-Antibody-Western-Blot-NBP1-82454-img0009.jpg "Western Blot: SUB1 Antibody [NBP1-82454] - Analysis in human cell line RPMI-8226.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQI |
| Predicted Species | Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SUB1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 27270442). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SUB1 Antibody (NBP1-82454)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SUB1 |
![Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SUB1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82454-img0011.jpg "Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://images.novusbio.com/fullsize/SUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-82454-img0015.jpg "Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/SUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-82454-img0012.jpg "Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.")
![Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/SUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-82454-img0013.jpg "Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human rectum shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human tonsil shows strong nuclear positivity in non - germinal center cells.](http://images.novusbio.com/fullsize/SUB1-Antibody-Immunohistochemistry-Paraffin-NBP1-82454-img0014.jpg "Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human tonsil shows strong nuclear positivity in non - germinal center cells.")
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")