![Western Blot: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Western blot analysis of extracts of Rat liver, using CYP26A1 Rabbit mAb (NBP3-16627) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/CYP26A1-Antibody-1E1D2-Western-Blot-NBP3-16627-img0005.jpg "Western Blot: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Western blot analysis of extracts of Rat liver, using CYP26A1 Rabbit mAb (NBP3-16627) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 1E1D2 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 201-450 of human CYP26A1 (O43174). AGDGDSEQQLVEAFEEMTRNLFSLPIDVPFSGLYRGMKARNLIHARIEQNIRAKICGLRASEAGQGCKDALQLLIEHSWERGERLDMQALKQSSTELLFGGHETTASAATSLITYLGLYPHVLQKVREELKSKGLLCKSNQDNKLDMEILEQLKYIGCVIKETLRLNPPVPGGFRVALKTFELNGYQIPKGWNVIYSICDTHDVAEIFTNKEEFNPDRFMLPHPEDASRFSFIPFGGGLRSCVGKEFAKI |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CYP26A1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CYP26A1 Antibody (NBP3-16627)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CYP26A1 |
![Immunocytochemistry/Immunofluorescence: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Immunofluorescence analysis of mouse placenta cells using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CYP26A1-Antibody-1E1D2-Immunocytochemistry-Immunofluorescence-NBP3-16627-img0004.jpg "Immunocytochemistry/Immunofluorescence: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Immunofluorescence analysis of mouse placenta cells using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Human breast using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/CYP26A1-Antibody-1E1D2-Immunohistochemistry-Paraffin-NBP3-16627-img0001.jpg "Immunohistochemistry-Paraffin: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Human breast using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Immunofluorescence analysis of rat placenta cells using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CYP26A1-Antibody-1E1D2-Immunocytochemistry-Immunofluorescence-NBP3-16627-img0002.jpg "Immunocytochemistry/Immunofluorescence: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Immunofluorescence analysis of rat placenta cells using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Immunofluorescence analysis of human placenta cells using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CYP26A1-Antibody-1E1D2-Immunocytochemistry-Immunofluorescence-NBP3-16627-img0003.jpg "Immunocytochemistry/Immunofluorescence: CYP26A1 Antibody (1E1D2) [NBP3-16627] - Immunofluorescence analysis of human placenta cells using CYP26A1 Rabbit mAb (NBP3-16627) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunocytochemistry_10308.jpg)
![Immunohistochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1-A1_AF5869_Immunohistochemistry_10638.jpg)
![Simple Western Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aldehyde_Dehydrogenase_1A1_AF5869_Simple_Western_17067.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")