Home » SOS2 » SOS2 Antibodies » SOS2 Antibody
Novus Biologicals products are now on bio-techne.com

SOS2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: SOS2 Antibody [NBP2-55873] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunocytochemistry/ Immunofluorescence: SOS2 Antibody [NBP2-55873] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SOS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPVPLRPPEHFINCPFNLQPPPLGHLHRDSDWLRDISTCPNSPSTPPST
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOS2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SOS2 Recombinant Protein Antigen (NBP2-55873PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SOS2 Antibody

  • FLJ25596
  • guanine nucleotide exchange factor
  • guanine nucleotide releasing factor
  • son of sevenless (Drosophilia) homolog 2
  • son of sevenless homolog 2 (Drosophila)
  • son of sevenless homolog 2
  • SOS2
  • SOS-2

Background

SOS2 (son of sevenless homolog 2) is a human paralog of the Drosophila SOS gene. Drosophila SOS was originally identified as a gene that functioned downstream of the sevenless gene in the Ras/MAP kinase signaling pathway. SOS and its paralogs, SOS1 and SOS2, function as guanine nucleotide exchange factors that act on Ras-GTPases to cause release of GDP in exchange for GTP. Although targeted disruption of SOS1 results in embryonic lethality, disruption of SOS2 does not have any effects on mouse development, growth, or fertility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GEF-H1 Antibody
NBP2-21577
Western Blot GEF-H1 Antibody
Western Blot GEF-H1 Antibody
Western Blot GEF-H1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot SLC2A4RG Antibody (4C10)
Immunocytochemistry/ Immunofluorescence SLC2A4RG Antibody (4C10)
Species: Hu
Applications: ELISA, ICC/IF, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Rac1 Antibody
NB100-91266
Western Blot Rac1 Antibody
Immunohistochemistry Rac1 Antibody
Immunohistochemistry Rac1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Vav-1 [p Tyr160]
Antibody (751411) [Un ...
MAB37861
Simple Western Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]
Western Blot Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]
Immunocytochemistry Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, Simple Western, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin RhoD Antibody
Western Blot RhoD Antibody
Immunohistochemistry RhoD Antibody
Species: Hu
Applications: IHC, IHC-P, WB
RhoA Antibody
NB100-91273
Immunocytochemistry/ Immunofluorescence RhoA Antibody
Immunohistochemistry-Paraffin RhoA Antibody
Immunocytochemistry/ Immunofluorescence RhoA Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
RASGRF1 Antibody
NBP3-13291
Western Blot RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Species: Mu, Rt
Applications: WB
RAPGEF3 Antibody -
BSA Free
NBP2-81767
Western Blot RAPGEF3 Antibody - BSA Free
Immunohistochemistry RAPGEF3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence RAPGEF3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Rabex5 Antibody
NBP1-49938
Western Blot Rabex5 Antibody
Immunohistochemistry-Paraffin Rabex5 Antibody
Western Blot Rabex5 Antibody
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
GRB2 Antibody
[Unconjugated]
AF3846
Western Blot GRB2 Antibody [Unconjugated]
Immunohistochemistry GRB2 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
Pleckstrin Antibody
NB100-1343
Immunohistochemistry-Paraffin Pleckstrin Antibody
Immunohistochemistry-Paraffin Pleckstrin Antibody
Western Blot Pleckstrin Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Rap1A/B Antibody
[Unconjugated]
AF3767
Western Blot Rap1A/B Antibody [Unconjugated]
Western Blot Rap1A/B Antibody [Unconjugated]
Immunohistochemistry Rap1A/B Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(834 Publications)
Species: Hu
Applications: BA
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
SOS2 Antibody
NBP2-55873
SOS2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for SOS2 Antibody (NBP2-55873) (0)

There are no publications for SOS2 Antibody (NBP2-55873).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOS2 Antibody (NBP2-55873) (0)

There are no reviews for SOS2 Antibody (NBP2-55873). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SOS2 Antibody (NBP2-55873) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOS2 Products

Array NBP2-55873

Research Areas for SOS2 Antibody (NBP2-55873)

Find related products by research area.

Blogs on SOS2

There are no specific blogs for SOS2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOS2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SOS2