![Western Blot: SNF5 Antibody [NBP1-90013] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/SNF5-Antibody-Western-Blot-NBP1-90013-img0010.jpg "Western Blot: SNF5 Antibody [NBP1-90013] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SMARCB1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SNF5 Antibody (NBP1-90013)Find related products by research area.
|
|
You can't be without me - SNF5 The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SMARCB1 |
![Western Blot: SNF5 Antibody [NBP1-90013] - Analysis using Anti-SMARCB1 antibody NBP1-90013 (A) shows similar pattern to independent antibody NBP1-90014 (B).](http://images.novusbio.com/fullsize/SNF5-Antibody-Western-Blot-NBP1-90013-img0009.jpg "Western Blot: SNF5 Antibody [NBP1-90013] - Analysis using Anti-SMARCB1 antibody NBP1-90013 (A) shows similar pattern to independent antibody NBP1-90014 (B).")
![Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human liver shows very weak positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/SNF5-Antibody-Immunohistochemistry-Paraffin-NBP1-90013-img0013.jpg "Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human liver shows very weak positivity in hepatocytes as expected.")
![Western Blot: SNF5 Antibody [NBP1-90013] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/SNF5-Antibody-Western-Blot-NBP1-90013-img0008.jpg "Western Blot: SNF5 Antibody [NBP1-90013] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human tonsil shows nuclear positivity.](http://images.novusbio.com/fullsize/SNF5-Antibody-Immunohistochemistry-Paraffin-NBP1-90013-img0007.jpg "Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human tonsil shows nuclear positivity.")
![Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells and in cells in granular and molecular layer.](http://images.novusbio.com/fullsize/SNF5-Antibody-Immunohistochemistry-Paraffin-NBP1-90013-img0011.jpg "Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells and in cells in granular and molecular layer.")
![Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human duodenum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/SNF5-Antibody-Immunohistochemistry-Paraffin-NBP1-90013-img0012.jpg "Immunohistochemistry-Paraffin: SNF5 Antibody [NBP1-90013] - Staining of human duodenum shows strong nuclear positivity in glandular cells.")
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")