![Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Western-Blot-NBP1-87757-img0012.jpg "Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NF2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Yongkang Yang |
WB | Human | 11/24/2022 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for NF2/Merlin Antibody (NBP1-87757)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NF2 |
![Western Blot: NF2/Merlin Antibody [NBP1-87757] - Whole cell lysates from SUM159, MDA-MB-231 and MCF-7 cells were loaded with 50 ug/lane. 10% SDS-PAGE. NF2/Merlin Antibody (NBP1-87757) was used for primary antibody: 1:1000, 4C, overnight. Image from verified customer review.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Western-Blot-NBP1-87757-img0013.jpg "Western Blot: NF2/Merlin Antibody [NBP1-87757] - Whole cell lysates from SUM159, MDA-MB-231 and MCF-7 cells were loaded with 50 ug/lane. 10% SDS-PAGE. NF2/Merlin Antibody (NBP1-87757) was used for primary antibody: 1:1000, 4C, overnight. Image from verified customer review.")
![Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP1-87757] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87757-img0008.jpg "Immunocytochemistry/Immunofluorescence: NF2/Merlin Antibody [NBP1-87757] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human fallopian tube shows moderate cytoplasmic and moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Immunohistochemistry-Paraffin-NBP1-87757-img0011.jpg "Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human fallopian tube shows moderate cytoplasmic and moderate membranous positivity in glandular cells.")
![Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Western-Blot-NBP1-87757-img0007.jpg "Western Blot: NF2/Merlin Antibody [NBP1-87757] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Immunohistochemistry-Paraffin-NBP1-87757-img0001.jpg "Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Immunohistochemistry-Paraffin-NBP1-87757-img0009.jpg "Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/NF2-Merlin-Antibody-Immunohistochemistry-Paraffin-NBP1-87757-img0010.jpg "Immunohistochemistry-Paraffin: NF2/Merlin Antibody [NBP1-87757] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
