Reactivity | HuSpecies Glossary |
Applications | AC |
Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human p62/SQSTM1. Source: E. coli Amino Acid Sequence: GELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source | E. coli |
Protein/Peptide Type | Recombinant Protein Antigen |
Gene | SQSTM1 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56317. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW | 27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for p62/SQSTM1 Recombinant Protein Antigen (NBP2-56317PEP)Find related products by research area.
|
Understanding Mitophagy Mechanisms: Canonical PINK1/Parkin, LC3-Dependent Piecemeal, and LC3-Independent Mitochondrial Derived Vesicles By Christina Towers, PhD What is Mitophagy?The selective degradation of mitochondria via double membrane autophagosome vesicles is called mitophagy. Damaged mitochondria can generate harmful amounts of reactive ox... Read full blog post. |
Autophagy Research Update: What a difference a year makes! By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque... Read full blog post. |
Autophagy and Metastasis By Christina Towers, PhD The majority of cancer patients die from metastatic disease at secondary sites. The threshold to undergo metastasis is high. Only a minority of cancer cells acquire invasive phenotypes... Read full blog post. |
Optogenetic Control of Mitophagy: AMBRA1 based mitophagy switch By Christina Towers, PhD Mitophagy in the BrainSelective autophagic degradation of damaged mitochondria, known as mitophagy, has been described as a cyto-protective process. Accordingly, defects in mitophagy h... Read full blog post. |
Read full blog post. |
How to visualize autophagy by microscopy By Christina Towers, PhD Autophagy is a recycling process that relies on the formation of a unique organelle termed an autophagosome. An elegant way to monitor autophagy is through various microscopy techniques to... Read full blog post. |
RNA-binding protein Staufen1 conspires with Atxn2 in stress granules to cause neurodegeneration by dysregulating RNA metabolism By Jamshed Arslan Pharm.D. Spinocerebellar ataxia type 2 (SCA2) is a movement disorder characterized by neurodegeneration. The cause of this autosomal dominant disease is a mutation in the RNA processing gene Atxn2,... Read full blog post. |
How a cell "reaches" out for help By Christina Towers, PhD. Parkinson's disease is a debilitating neurodegenerative condition defined by the accumulation of alpha-synuclein-containing (alpha-SYN) intra-cytoplasmic inclusions, called Lewy bodies. The ... Read full blog post. |
Measuring Autophagic Flux with LC3 protein levels: The do's and don'ts By Christina Towers, PhD. Autophagy is a dynamic cellular recycling process that can be influenced by many different external and internal stimuli. The most commonly used assay to measure autophagy is a western blot f... Read full blog post. |
Crosstalk Between Oxidative Stress and Autophagy By Christina Towers, PhD. Role of Reactive Species in Cellular FunctionOxidative stress is a byproduct of an imbalance between oxidants and antioxidants present in the cell, resulting in dysfunctional redox si... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SQSTM1 |