![Immunohistochemistry: NG2/MCSP Antibody [NBP1-89682] - NG2/CSPG4 immunohistochemistry in oligodendroglial tumors. (A) WHO grade II oligodendroglioma. Isolated tumor cells (arrow) with NG2/CSPG4+ cell membranes; DAB, 400x. (B) WHO grade III oligodendroglioma. NG2/CSPG4-positive area with honeycomb appearance; DAB, OM 400x. (C) Id. Isolated CNPase-positive tumor cells in infiltration area; DAB, OM 400x. (D) Id. Sox10-positive tumour cells; DAB, OM 200x. (E) Id. NG2/CSPG4-positive reactive astrocytes inside the tumor; DAB, OM 200x. (F) Id. GFAP-positive reactive astrocytes (arrow) intermingled with GFAP-negative tumor cells; DAB, OM 400x. (G) Id. GFAP-positive (alkaline phosphatase red) and mIDH1R132H-negative reactive astrocytes (arrow) intermingled with mIDH1R132H-positive (DAB) and GFAP-negative tumor oligodendrocytes (arrow); OM 400x. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/9/6/1538) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NG2-MCSP-Antibody-Immunohistochemistry-NBP1-89682-img0010.jpg "Immunohistochemistry: NG2/MCSP Antibody [NBP1-89682] - NG2/CSPG4 immunohistochemistry in oligodendroglial tumors. (A) WHO grade II oligodendroglioma. Isolated tumor cells (arrow) with NG2/CSPG4+ cell membranes; DAB, 400x. (B) WHO grade III oligodendroglioma. NG2/CSPG4-positive area with honeycomb appearance; DAB, OM 400x. (C) Id. Isolated CNPase-positive tumor cells in infiltration area; DAB, OM 400x. (D) Id. Sox10-positive tumour cells; DAB, OM 200x. (E) Id. NG2/CSPG4-positive reactive astrocytes inside the tumor; DAB, OM 200x. (F) Id. GFAP-positive reactive astrocytes (arrow) intermingled with GFAP-negative tumor cells; DAB, OM 400x. (G) Id. GFAP-positive (alkaline phosphatase red) and mIDH1R132H-negative reactive astrocytes (arrow) intermingled with mIDH1R132H-positive (DAB) and GFAP-negative tumor oligodendrocytes (arrow); OM 400x. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/9/6/1538) licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CSPG4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Chromatin Immunoprecipitation (ChIP) Olig2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Olig2_AF2418_Chromatin_Immunoprecipitation_11228.jpg)
![Immunocytochemistry Olig2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Olig2_AF2418_Immunocytochemistry_6637.jpg)
![Immunohistochemistry Olig2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Olig2_AF2418_Immunohistochemistry_17205.jpg)
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_10287.jpg)
![Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Flow_Cytometry_16017.jpg)
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_21486.jpg)
| Publication using NBP1-89682 | Applications | Species |
|---|---|---|
| Mellai M, Annovazzi L, Bisogno I et al. Chondroitin Sulphate Proteoglycan 4 (NG2/CSPG4) Localization in Low- and High-Grade Gliomas Cells 2020-06-24 [PMID: 32599896] (Human) | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for NG2/MCSP Antibody (NBP1-89682)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: NG2/MCSP Antibody [NBP1-89682] - Analysis in control (vector only transfected HEK293T lysate) and CSPG4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/NG2-MCSP-Antibody-Western-Blot-NBP1-89682-img0009.jpg "Western Blot: NG2/MCSP Antibody [NBP1-89682] - Analysis in control (vector only transfected HEK293T lysate) and CSPG4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: NG2/MCSP Antibody [NBP1-89682] - Immunofluorescence (IF) analysis of NG2/CSPG4 expression in glioblastoma (GB)-derived human cell lines. IF of a GB-derived neurosphere cell line for (A) NG2/CSPG4 (green), original magnification (OM) 200x; IF staining of an adherent cell line for (E) NG2/CSPG4 (green), OM 400x; Nuclei were counterstained with DAPI (blue). Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/9/6/1538) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NG2-MCSP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89682-img0013.jpg "Immunocytochemistry/Immunofluorescence: NG2/MCSP Antibody [NBP1-89682] - Immunofluorescence (IF) analysis of NG2/CSPG4 expression in glioblastoma (GB)-derived human cell lines. IF of a GB-derived neurosphere cell line for (A) NG2/CSPG4 (green), original magnification (OM) 200x; IF staining of an adherent cell line for (E) NG2/CSPG4 (green), OM 400x; Nuclei were counterstained with DAPI (blue). Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/9/6/1538) licensed under a CC-BY license.")
![Immunohistochemistry: NG2/MCSP Antibody [NBP1-89682] - (A) WHO grade II astrocytoma. NG2/CSPG4-negative tumor cells and -positive reactive astrocytes; DAB, original magnification (OM) 200x. (B) IDH-wild type glioblastoma (GB). Area of NG2/CSPG4-positive cells; DAB, OM 200x. (C) Id. NG2/CSPG4-positive tumor cells and reactive astrocytes oriented on vessels; DAB, OM 200x. (D) Id. NG2/CSPG4-negative area of necrosis; DAB, OM 200x. (E) Id. NG2/CSPG4-positive vascular pericytes in microvascular proliferations; DAB, OM 200x. (F) Id. NG2/CSPG4-positive pericytes in a glomerulus with sprout; DAB, OM 200x. (G) Id. a-SMA-positive pericytes in infiltration area; DAB, OM 200x. (H) Id. PDGFRB-positive pericytes in hyperproliferative area. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/9/6/1538) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NG2-MCSP-Antibody-Immunohistochemistry-NBP1-89682-img0011.jpg "Immunohistochemistry: NG2/MCSP Antibody [NBP1-89682] - (A) WHO grade II astrocytoma. NG2/CSPG4-negative tumor cells and -positive reactive astrocytes; DAB, original magnification (OM) 200x. (B) IDH-wild type glioblastoma (GB). Area of NG2/CSPG4-positive cells; DAB, OM 200x. (C) Id. NG2/CSPG4-positive tumor cells and reactive astrocytes oriented on vessels; DAB, OM 200x. (D) Id. NG2/CSPG4-negative area of necrosis; DAB, OM 200x. (E) Id. NG2/CSPG4-positive vascular pericytes in microvascular proliferations; DAB, OM 200x. (F) Id. NG2/CSPG4-positive pericytes in a glomerulus with sprout; DAB, OM 200x. (G) Id. a-SMA-positive pericytes in infiltration area; DAB, OM 200x. (H) Id. PDGFRB-positive pericytes in hyperproliferative area. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/2073-4409/9/6/1538) licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human placenta shows moderate membranous and cytoplasmic positivity in trophoblast.](http://images.novusbio.com/fullsize/NG2-MCSP-Antibody-Immunohistochemistry-Paraffin-NBP1-89682-img0005.jpg "Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human placenta shows moderate membranous and cytoplasmic positivity in trophoblast.")
![Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NG2-MCSP-Antibody-Immunohistochemistry-Paraffin-NBP1-89682-img0006.jpg "Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human prostate shows moderate membranous and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.](http://images.novusbio.com/fullsize/NG2-MCSP-Antibody-Immunohistochemistry-Paraffin-NBP1-89682-img0007.jpg "Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.")
![Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NG2-MCSP-Antibody-Immunohistochemistry-Paraffin-NBP1-89682-img0008.jpg "Immunohistochemistry-Paraffin: NG2/MCSP Antibody [NBP1-89682] - Immunohistochemical staining of human duodenum shows moderate membranous and cytoplasmic positivity in glandular cells.")
![Immunocytochemistry/ Immunofluorescence: NG2/MCSP Antibody [NBP1-89682] - Immunofluorescence (IF) analysis of NG2/CSPG4 expression in glioblastoma (GB)-derived human cell lines. IF of a GB-derived neurosphere cell line for (A) NG2/CSPG4 (green), original magnification (OM) ×200; (B) Nestin (red), OM ×200; (C) MSel1 (red), OM ×200; (D) Notch-2 (green), OM ×200. IF staining of an adherent cell line for (E) NG2/CSPG4 (green), OM ×400; (F) GFAP (green), OM ×400; (G) beta -III Tubulin (red), OM ×200; (H) Galactocerebroside C (red), OM ×200. Nuclei were counterstained with DAPI (blue). DAPI, 4′,6-diamidino-2-phenylindole. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32599896), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89682_rabbit-polyclonal-ng2-mcsp-antibody-31020241539744.jpg "Immunocytochemistry/ Immunofluorescence: NG2/MCSP Antibody [NBP1-89682] - Immunofluorescence (IF) analysis of NG2/CSPG4 expression in glioblastoma (GB)-derived human cell lines. IF of a GB-derived neurosphere cell line for (A) NG2/CSPG4 (green), original magnification (OM) ×200; (B) Nestin (red), OM ×200; (C) MSel1 (red), OM ×200; (D) Notch-2 (green), OM ×200. IF staining of an adherent cell line for (E) NG2/CSPG4 (green), OM ×400; (F) GFAP (green), OM ×400; (G) beta -III Tubulin (red), OM ×200; (H) Galactocerebroside C (red), OM ×200. Nuclei were counterstained with DAPI (blue). DAPI, 4′,6-diamidino-2-phenylindole. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32599896), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images2/Nestin_MAB1259_Immunocytochemistry_6561.jpg)
![Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1259_human-nestin-mab-clone-196908-intracellular-staining-by-flow-cytometry-24120239959.jpg)
![Western Blot Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/mab1259_human-nestin-mab-clone-196908-41202410481129.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")