![Western Blot: Lgl1 Antibody [NBP3-15981] - Analysis of extracts of various cell lines, using Lgl1 antibody (NBP3-15981) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Western-Blot-NBP3-15981-img0005.jpg "Western Blot: Lgl1 Antibody [NBP3-15981] - Analysis of extracts of various cell lines, using Lgl1 antibody (NBP3-15981) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human Lgl1 (NP_004131.3). MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVTVVLLVAAGDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LLGL1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LLGL1 |
![Immunocytochemistry/Immunofluorescence: Lgl1 Antibody [NBP3-15981] - Immunofluorescence analysis of C6 cells using Lgl1 antibody (NBP3-15981) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-15981-img0004.jpg "Immunocytochemistry/Immunofluorescence: Lgl1 Antibody [NBP3-15981] - Immunofluorescence analysis of C6 cells using Lgl1 antibody (NBP3-15981) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP3-15981] - Human breast cancer using Lgl1 antibody (NBP3-15981) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Immunohistochemistry-Paraffin-NBP3-15981-img0002.jpg "Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP3-15981] - Human breast cancer using Lgl1 antibody (NBP3-15981) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Western Blot: Lgl1 Antibody [NBP3-15981] - Analysis of extracts of Rat testis, using Lgl1 antibody (NBP3-15981) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Western-Blot-NBP3-15981-img0006.jpg "Western Blot: Lgl1 Antibody [NBP3-15981] - Analysis of extracts of Rat testis, using Lgl1 antibody (NBP3-15981) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.")
![Immunocytochemistry/Immunofluorescence: Lgl1 Antibody [NBP3-15981] - Immunofluorescence analysis of A-549 cells using Lgl1 antibody (NBP3-15981) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-15981-img0003.jpg "Immunocytochemistry/Immunofluorescence: Lgl1 Antibody [NBP3-15981] - Immunofluorescence analysis of A-549 cells using Lgl1 antibody (NBP3-15981) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP3-15981] - Human liver cancer using Lgl1 antibody (NBP3-15981) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Lgl1-Antibody-Immunohistochemistry-Paraffin-NBP3-15981-img0001.jpg "Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP3-15981] - Human liver cancer using Lgl1 antibody (NBP3-15981) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/ Immunofluorescence: Lgl1 Antibody - Azide and BSA Free [Lgl1] - Immunofluorescence analysis of A-549 cells using Lgl1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-15981_rabbit-lgl1-pab-52202517162356.jpg "Immunocytochemistry/ Immunofluorescence: Lgl1 Antibody - Azide and BSA Free [Lgl1] - Immunofluorescence analysis of A-549 cells using Lgl1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Lgl1 Antibody - Azide and BSA Free [Lgl1] - Immunofluorescence analysis of C6 cells using Lgl1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-15981_rabbit-lgl1-pab-5220251726045.jpg "Immunocytochemistry/ Immunofluorescence: Lgl1 Antibody - Azide and BSA Free [Lgl1] - Immunofluorescence analysis of C6 cells using Lgl1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")