![Western Blot: PPP1R3B Antibody [H00079660-B01P] - Analysis of PPP1R3B expression in rat brain.](http://images.novusbio.com/fullsize/PPP1R3B-Antibody-Western-Blot-H00079660-B01P-img0004.jpg "Western Blot: PPP1R3B Antibody [H00079660-B01P] - Analysis of PPP1R3B expression in rat brain.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | PPP1R3B (AAH43388.1, 1 a.a. - 285 a.a.) full-length human protein. MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY |
| Specificity | PPP1R3B - protein phosphatase 1, regulatory (inhibitor) subunit 3B, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PPP1R3B |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Publication using H00079660-B01P | Applications | Species |
|---|---|---|
| Noguchi Y, Kano F, Maiya N Et Al. Microscopic image-based covariation network analysis for actin scaffold-modified insulin signaling iScience 2021-07-01 [PMID: 34337357] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPP1R3B |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: PPP1R3B Antibody [H00079660-B01P] - Analysis of purified antibody to PPP1R3B on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/PPP1R3B-Antibody-Immunocytochemistry-Immunofluorescence-H00079660-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: PPP1R3B Antibody [H00079660-B01P] - Analysis of purified antibody to PPP1R3B on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: PPP1R3B Antibody [H00079660-B01P] - Analysis of PPP1R3B expression in transfected 293T cell line by PPP1R3B polyclonal antibody. Lane 1: PPP1R3B transfected lysate(31.46 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PPP1R3B-Antibody-Western-Blot-H00079660-B01P-img0005.jpg "Western Blot: PPP1R3B Antibody [H00079660-B01P] - Analysis of PPP1R3B expression in transfected 293T cell line by PPP1R3B polyclonal antibody. Lane 1: PPP1R3B transfected lysate(31.46 KDa). Lane 2: Non-transfected lysate.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")