OSTM1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: REAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
OSTM1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (89%).
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for OSTM1 Antibody
Background
OSTM1 encodes a protein that may be involved in the degradation of G proteins via the ubiquitin-dependent proteasome pathway. The encoded protein binds to members of subfamily A of the regulator of the G-protein signaling (RGS) family through an N-terminal leucine-rich region. This protein also has a central RING finger-like domain and E3 ubiquitin ligase activity. This protein is highly conserved from flies to humans. Defects in this gene may cause the autosomal recessive, infantile malignant form of osteopetrosis. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB, IHC
Publications for OSTM1 Antibody (NBP1-81829)(2)
Showing Publications 1 -
2 of 2.
Reviews for OSTM1 Antibody (NBP1-81829) (0)
There are no reviews for OSTM1 Antibody (NBP1-81829).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for OSTM1 Antibody (NBP1-81829). (Showing 1 - 1 of 1 FAQs).
-
Does the OSTM1 antibody (NBP1-81829) work on murine tissues or proteins in western blot and immunohistochemistry (frozen sections)?
- Our OSTM1 antibody (NBP1-81829) has been validated in Human samples for WB/IHC-P applications only. There is a considerable similarity in the immunogen sequence used for this product when compared the same to the OSTM1 sequence of mouse protein, so that there is a pretty good chance of cross-reactivity. Therefore, you may optimize the best suitable conditions for the assay from your testing, and we would be more than happy to provide you our troubleshooting/technical feedback if you come up with any problems in generating your desired outcome. If you decide to test OSTM1 (NBP1-81829) in Mouse/IHC-Fr, and share your results/review feedback with us, please consider our Innovator's Reward program.
Secondary Antibodies
| |
Isotype Controls
|
Additional OSTM1 Products
Research Areas for OSTM1 Antibody (NBP1-81829)
Find related products by research area.
|
Blogs on OSTM1