Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acid sequence: QYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLS |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PROM1 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD133 Antibody (NBP2-59787)Find related products by research area.
|
Stemness is responsible for onset and metastasis of colorectal cancer By Jamshed Arslan, Pharm. D., PhD. Colorectal cancer stem cells are a rare subpopulation of colorectal cancer cells that can self-renew and initiate and sustain tumor growth when transplanted into an animal host.1,2 C... Read full blog post. |
ATG9A - early marker autophagosome assembly ATG9A is the only essential integral membrane protein involved in autophagy. ATG9A contains six transmembrane domains and initiates the assembly of autophagosomes. The autophagosome is a double-membrane structure that engulfs and eventually degrade... Read full blog post. |
CD133 Also known as PROM1 and AC133, this gene is located on chromosome 4p15 and encodes CD133, a 120kDa pentaspan transmembrane glycoprotein (5-TM) and presents multiple spliced variants. Prominin-1 (CD133) was the first protein identified as "Prominin"; o... Read full blog post. |
CD Antibodies Uncover Markers for Rare Breast Cancer We at Novus Biologicals have added several new products to our CD antibody database. The CD, or Cluster of Differential proteins are a family of type I transmembrane glycoproteins widely expressed in immune cell populations. These include B cells, thy... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | PROM1 |