CCR9 Antibody Summary
Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein CCR9 using the following amino acid sequence: MADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CCR9 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CCR9 Antibody
Background
CCR9 is encoded by this gene is a member of the beta chemokine receptor family. It is predicted to be a seven transmembrane protein similar to G protein coupled receptors. Chemokines and their receptors are key regulators of the thymocytes migration and maturation in normal and inflammation conditions. This gene is expressed in a range of tissues and hemopoietic cells. The expression of this receptor in lymphatic endothelial cells and overexpression in vascular tumors suggested its function in chemokine-driven recirculation of leukocytes and possible chemokine effects on the development and growth of vascular tumors. This receptor appears to bind the majority of beta-chemokine family members; however, its specific function remains unknown. The specific ligand of this receptor is CCL25. It has been found that this gene is differentially expressed by T lymphocytes of small intestine and colon, suggested a role in the thymocytes recruitment and development that may permit functional specialization of immune responses in different segment of the gastrointestinal tract. This gene is mapped to chromosome 3p21.3, a region that includes a cluster of chemokine receptor genes. Two alternatively spliced transcript variants have been described.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Hu
Applications: CyTOF-ready, Flow
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, IHC, IHC-Fr, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Fe, Hu, RM
Applications: BA, BA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
Species: Hu
Applications: ICC/IF
Publications for CCR9 Antibody (NBP3-24721) (0)
There are no publications for CCR9 Antibody (NBP3-24721).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CCR9 Antibody (NBP3-24721) (0)
There are no reviews for CCR9 Antibody (NBP3-24721).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CCR9 Antibody (NBP3-24721) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CCR9 Products
Research Areas for CCR9 Antibody (NBP3-24721)
Find related products by research area.
|
Blogs on CCR9