![Western Blot: VTA1 Antibody [NBP1-86745] - Analysis using Anti-VTA1 antibody NBP1-86745 (A) shows similar pattern to independent antibody NBP2-58305 (B).](http://images.novusbio.com/fullsize/VTA1-Antibody-Western-Blot-NBP1-86745-img0005.jpg "Western Blot: VTA1 Antibody [NBP1-86745] - Analysis using Anti-VTA1 antibody NBP1-86745 (A) shows similar pattern to independent antibody NBP2-58305 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | VTA1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for VTA1 Antibody (NBP1-86745)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | VTA1 |
![Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/VTA1-Antibody-Immunohistochemistry-Paraffin-NBP1-86745-img0008.jpg "Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.](http://images.novusbio.com/fullsize/VTA1-Antibody-Immunohistochemistry-Paraffin-NBP1-86745-img0002.jpg "Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.")
![Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/VTA1-Antibody-Immunohistochemistry-Paraffin-NBP1-86745-img0006.jpg "Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human cerebral cortex shows weak positivity in neurons.](http://images.novusbio.com/fullsize/VTA1-Antibody-Immunohistochemistry-Paraffin-NBP1-86745-img0007.jpg "Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human cerebral cortex shows weak positivity in neurons.")
![Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human skeletal muscle shows negative to very weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/VTA1-Antibody-Immunohistochemistry-Paraffin-NBP1-86745-img0009.jpg "Immunohistochemistry-Paraffin: VTA1 Antibody [NBP1-86745] - Staining of human skeletal muscle shows negative to very weak cytoplasmic positivity in myocytes.")
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")