![Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Analysis in human prostate and skeletal muscle tissues. Corresponding NDRG1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NDRG1-Antibody-Immunohistochemistry-Paraffin-NBP1-86636-img0012.jpg "Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Analysis in human prostate and skeletal muscle tissues. Corresponding NDRG1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: INVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLL |
| Predicted Species | Mouse (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NDRG1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P, Retrieval method: HIER pH6, ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
| Publications using NBP1-86636 | Applications | Species |
|---|---|---|
| Mao Z, Sun J, Feng B et al. The Metastasis Suppressor, N-myc Downregulated Gene 1 (NDRG1), Is a Prognostic Biomarker for Human Colorectal Cancer. PLoS One 2013-01-01 [PMID: 23874544] | ||
| Lane DJ, Saletta F, Rahmanto YS et al. N-myc Downstream Regulated 1 (NDRG1) Is Regulated by Eukaryotic Initiation Factor 3a (eIF3a) during Cellular Stress Caused by Iron Depletion. PLoS One 2013-01-01 [PMID: 23437357] | ||
| Drogemuller C, Becker D, Kessler B et al. A deletion in the N-myc downstream regulated gene 1 (NDRG1) gene in Greyhounds with polyneuropathy. PLoS One 2010-06-01 [PMID: 20582309] | ||
| Schilling SH, Hjelmeland AB, Radiloff DR et al. NDRG4 Is Required for Cell Cycle Progression and Survival in Glioblastoma Cells. J Biol Chem 2009-09-11 [PMID: 19592488] | ||
| Rakopoulos P Investigating the role of H3. 3K27M during cellular transformation and differentiation. Thesis 2020-01-01 (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for NDRG1 Antibody (NBP1-86636)Find related products by research area.
|
|
Suppressing breast cancer metastasis: The role of hypoxia-induced RhoB expression and activation By Jamshed Arslan, Pharm. D., PhD. The Ras homologous (Rho) GTPase family of signaling molecules has over 20 members, which typically cycle between active (GTP-bound) and inactive (GDP-bound) states. These small GTPa... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NDRG1 |
![Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in human cell lines HEK293 and MCF-7. Corresponding NDRG1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize/NDRG1-Antibody-Western-Blot-NBP1-86636-img0011.jpg "Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in human cell lines HEK293 and MCF-7. Corresponding NDRG1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.")
![Immunocytochemistry/Immunofluorescence: NDRG1 Antibody [NBP1-86636] - Staining of human cell line U-2 OS shows localization to cytosol & microtubules. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NDRG1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86636-img0008.jpg "Immunocytochemistry/Immunofluorescence: NDRG1 Antibody [NBP1-86636] - Staining of human cell line U-2 OS shows localization to cytosol & microtubules. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human prostate shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/NDRG1-Antibody-Immunohistochemistry-Paraffin-NBP1-86636-img0016.jpg "Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human prostate shows strong membranous positivity in glandular cells.")
![Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/NDRG1-Antibody-Western-Blot-NBP1-86636-img0007.jpg "Western Blot: NDRG1 Antibody [NBP1-86636] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human colon shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/NDRG1-Antibody-Immunohistochemistry-Paraffin-NBP1-86636-img0013.jpg "Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human colon shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human kidney shows moderate membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/NDRG1-Antibody-Immunohistochemistry-Paraffin-NBP1-86636-img0014.jpg "Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human kidney shows moderate membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.](http://images.novusbio.com/fullsize/NDRG1-Antibody-Immunohistochemistry-Paraffin-NBP1-86636-img0015.jpg "Immunohistochemistry-Paraffin: NDRG1 Antibody [NBP1-86636] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")