![Western Blot: IST1 Antibody [NBP2-33720] - Analysis using Anti-IST1 antibody NBP2-33720 (A) shows similar pattern to independent antibody NBP1-87676 (B).](http://images.novusbio.com/fullsize/IST1-Antibody-Western-Blot-NBP2-33720-img0008.jpg "Western Blot: IST1 Antibody [NBP2-33720] - Analysis using Anti-IST1 antibody NBP2-33720 (A) shows similar pattern to independent antibody NBP1-87676 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLL |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IST1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
![Western Blot AMSH/STAMBP Antibody [Unconjugated]](https://images.novusbio.com/images2/AMSH_AF5650_Western_Blot_5795.jpg)
![Immunohistochemistry AMSH/STAMBP Antibody [Unconjugated]](https://images.novusbio.com/images2/AMSH_AF5650_Immunohistochemistry_19609.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for IST1 Antibody (NBP2-33720)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: IST1 Antibody [NBP2-33720] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/IST1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33720-img0006.jpg "Immunocytochemistry/Immunofluorescence: IST1 Antibody [NBP2-33720] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: IST1 Antibody [NBP2-33720] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/IST1-Antibody-Immunohistochemistry-Paraffin-NBP2-33720-img0013.jpg "Immunohistochemistry-Paraffin: IST1 Antibody [NBP2-33720] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: IST1 Antibody [NBP2-33720] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/IST1-Antibody-Immunohistochemistry-Paraffin-NBP2-33720-img0010.jpg "Immunohistochemistry-Paraffin: IST1 Antibody [NBP2-33720] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: IST1 Antibody [NBP2-33720] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/IST1-Antibody-Immunohistochemistry-Paraffin-NBP2-33720-img0011.jpg "Immunohistochemistry-Paraffin: IST1 Antibody [NBP2-33720] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: IST1 Antibody [NBP2-33720] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/IST1-Antibody-Immunohistochemistry-Paraffin-NBP2-33720-img0012.jpg "Immunohistochemistry-Paraffin: IST1 Antibody [NBP2-33720] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")