![Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining in human lymph node and liver tissues. Corresponding TMEM119 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TMEM119-Antibody-Immunohistochemistry-Paraffin-NBP2-30551-img0010.jpg "Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining in human lymph node and liver tissues. Corresponding TMEM119 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Rt, Po, FeSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMEM119 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
![Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunocytochemistry__Immunofluorescence_23325.jpg)
![Neutralization Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Block_Neutralize_8975.jpg)
![Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunohistochemistry_9333.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
ICC | Human | 05/20/2021 |
Summary
|
|||||||||||
Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Rat | 07/28/2020 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Sheep | 03/13/2020 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Vicki Swier |
IHC-P | Swine | 04/23/2018 |
Summary
Comments
|
||||||||||
|
reviewed by:
Verified Customer |
IHC-Fr | Feline | 01/31/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
|
Antibody treatment can generate microglia-like cells from bone marrow By Jennifer Sokolowski, MD, PhD.Microglia play important roles in the brain in both homeostatic and pathological conditions, acting to clear debris and dying cells. There is evidence to suggest that microglial dys... Read full blog post. |
|
TMEM 119 is a specific marker of microglia cells By Jennifer Sokolowski, MD, PhD.Microglia are a major immune-cell component in the brain. They ingest and degrade dead cells, debris, and foreign material and interact with other immune cells to orchestrate centra... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 05/20/2021 |
||
| Application: | ICC | |
| Species: | Human |
| Verified Customer 07/28/2020 |
||
| Application: | IHC-Fr | |
| Species: | Rat |
| Verified Customer 03/13/2020 |
||
| Application: | IHC-Fr | |
| Species: | Sheep |
![Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-TMEM119 antibody NBP2-30551 (A) shows similar protein distribution across tissues to independent antibody NBP2-30792 (B).](http://images.novusbio.com/fullsize/TMEM119-Antibody-Immunohistochemistry-Paraffin-NBP2-30551-img0014.jpg "Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-TMEM119 antibody NBP2-30551 (A) shows similar protein distribution across tissues to independent antibody NBP2-30792 (B).")
![Immunocytochemistry/Immunofluorescence: TMEM119 Antibody [NBP2-30551] - Human microglia cell line stained with TMEM antibody and DAPI. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/fullsize/TMEM119-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30551-img0016.jpg "Immunocytochemistry/Immunofluorescence: TMEM119 Antibody [NBP2-30551] - Human microglia cell line stained with TMEM antibody and DAPI. ICC/IF image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human cerebral cortex shows weak positivity in microglia.](http://images.novusbio.com/fullsize/TMEM119-Antibody-Immunohistochemistry-Paraffin-NBP2-30551-img0006.jpg "Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human cerebral cortex shows weak positivity in microglia.")
![Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/TMEM119-Antibody-Immunohistochemistry-Paraffin-NBP2-30551-img0007.jpg "Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.](http://images.novusbio.com/fullsize/TMEM119-Antibody-Immunohistochemistry-Paraffin-NBP2-30551-img0008.jpg "Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human testis shows weak membranous positivity in cells in lamina propria.](http://images.novusbio.com/fullsize/TMEM119-Antibody-Immunohistochemistry-Paraffin-NBP2-30551-img0009.jpg "Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human testis shows weak membranous positivity in cells in lamina propria.")
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Immunohistochemistry Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Immunohistochemistry_10106.jpg)
![Western Blot Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Western_Blot_5162.jpg)
![Simple Western Smad1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Smad1_AF2039_Simple_Western_16677.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
