![Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in NIH/3T3.](http://images.novusbio.com/fullsize/CDK2AP2-Antibody-Western-Blot-H00010263-B01P-img0006.jpg "Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in NIH/3T3.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | CDK2AP2 (AAH02850, 1 a.a. - 126 a.a.) full-length human protein. MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART |
| Specificity | CDK2AP2 - CDK2-associated protein 2, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CDK2AP2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CDK2AP2 Antibody (H00010263-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in PC-12.](http://images.novusbio.com/fullsize/CDK2AP2-Antibody-Western-Blot-H00010263-B01P-img0003.jpg "Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in PC-12.")
![Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in Hela S3 NE.](http://images.novusbio.com/fullsize/CDK2AP2-Antibody-Western-Blot-H00010263-B01P-img0004.jpg "Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in Hela S3 NE.")
![Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in Raw 264.7.](http://images.novusbio.com/fullsize/CDK2AP2-Antibody-Western-Blot-H00010263-B01P-img0005.jpg "Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in Raw 264.7.")
![Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in transfected 293T cell line by CDK2AP2 polyclonal antibody. Lane 1: CDK2AP2 transfected lysate(13.86 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CDK2AP2-Antibody-Western-Blot-H00010263-B01P-img0007.jpg "Western Blot: CDK2AP2 Antibody [H00010263-B01P] - Analysis of CDK2AP2 expression in transfected 293T cell line by CDK2AP2 polyclonal antibody. Lane 1: CDK2AP2 transfected lysate(13.86 KDa). Lane 2: Non-transfected lysate.")
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")