STAT6 Recombinant Protein Antigen

Images

 
There are currently no images for STAT6 Recombinant Protein Antigen (NBP1-85345PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

STAT6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAT6.

Source: E. coli

Amino Acid Sequence: VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STAT6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85345.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STAT6 Recombinant Protein Antigen

  • D12S1644
  • EC 2.4.1.227
  • EC 2.7.7.6
  • IL-4 Stat
  • IL-4-STAT
  • signal transducer and activator of transcription 6
  • signal transducer and activator of transcription 6, interleukin-4 induced
  • STAT, interleukin-4 induced
  • STAT, interleukin4-induced
  • STAT6
  • STAT6B
  • STAT6C
  • transcription factor IL-4 STAT

Background

Signal Transducer and Activator of Transcription 6 (STAT6) is a member of the Janus family tyrosine kinases (Jak)/ STAT signal transduction pathway and mediates cytokine signaling by IL 4 and IL-13 (1). STAT6 (predicted molecular weight 94kDa) has been found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL-4. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT6 is tyrosine phosphorylated (Tyr641) in response to cellular interaction with IL-4. STAT6 mRNA has been detected in peripheral blood lymphocytes, colon, intestine, ovary, prostate, thymus, spleen, kidney, liver, lung and placenta. STAT6 is critically involved in Th2 and Th9 immune response (2). Loss of STAT6 impairs IL-4 mediated functions including Th2 helper T cell differentiation, expression of cell surface markers, T-cell proliferation, immunoglobulin class switching to IgE, and partial loss of IL-4 mediated proliferation. Diseases associated with STAT6 include malignant hemangiopericytoma and nut allergies.

References

1. Waqas, S. F. H., Ampem, G., & Roszer, T. (2019). Analysis of IL-4/STAT6 Signaling in Macrophages. Methods Mol Biol, 1966, 211-224. doi:10.1007/978-1-4939-9195-2_17

2. Goenka, S., & Kaplan, M. H. (2011). Transcriptional regulation by STAT6. Immunol Res, 50(1), 87-96. doi:10.1007/s12026-011-8205-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

6507-IL/CF
Species: Hu
Applications: BA
DY413
Species: Mu
Applications: ELISA
NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NBP3-11412
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
MAB4260
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
M5000
Species: Mu
Applications: ELISA
NB600-922
Species: Ch
Applications: ELISA, IHC, Single-Cell Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-37737
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB

Publications for STAT6 Recombinant Protein Antigen (NBP1-85345PEP) (0)

There are no publications for STAT6 Recombinant Protein Antigen (NBP1-85345PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAT6 Recombinant Protein Antigen (NBP1-85345PEP) (0)

There are no reviews for STAT6 Recombinant Protein Antigen (NBP1-85345PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STAT6 Recombinant Protein Antigen (NBP1-85345PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STAT6 Products

Research Areas for STAT6 Recombinant Protein Antigen (NBP1-85345PEP)

Find related products by research area.

Blogs on STAT6.

Signal Transducer and Activator of Transcription STAT6: More than a Player in Allergic Inflammation
By Jamshed Arslan, Pharm. D., PhD. What is STAT6?The cellular pathway comprising tyrosine kinase Janus Kinase (JAK) and the transcription factor STAT connect extracellular signals from various cytokines, hormones an...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STAT6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STAT6