Home » SOX10 » SOX10 Proteins » Recombinant Human SOX10 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human SOX10 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human SOX10 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 336-433 of Human SOX10

Source: Wheat Germ (in vitro)

Amino Acid Sequence: KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SOX10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SOX10 GST (N-Term) Protein

  • DOM
  • MGC15649
  • PCWH
  • SOX10
  • SRY (sex determining region Y)-box 10
  • SRY-related HMG-box gene 10
  • transcription factor SOX-10
  • WS4
  • WS4C
  • WS4mouse, human homolog of

Background

SOX10 - SRY (sex determining region Y)-box 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SS18L1 Antibody
NBP2-20486
Immunoprecipitation SS18L1 Antibody
Immunohistochemistry-Paraffin SS18L1 Antibody
Immunocytochemistry/ Immunofluorescence SS18L1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MITF Antibody
AF5769
Western Blot MITF Antibody
Immunohistochemistry MITF Antibody
(9 Publications)
Species: Hu
Applications: IHC, WB
EDNRB/Endothelin R
Type B Antibody - BSA ...
NLS54
Immunohistochemistry-Paraffin EDNRB/Endothelin R Type B Antibody - BSA Free
Immunohistochemistry-Paraffin EDNRB/Endothelin R Type B Antibody - BSA Free
Immunohistochemistry-Paraffin EDNRB/Endothelin R Type B Antibody - BSA Free
(3 Publications)
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Pax3/Pax7 Antibody
(274212) [Unconjugate ...
MAB2457
Immunocytochemistry Pax3/Pax7 Antibody (274212) [Unconjugated]
Immunocytochemistry/ Immunofluorescence Pax3/Pax7 Antibody (274212) [Unconjugated]
(1 Review)
(19 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
Endothelin-3
Antibody (2A6-2A4)
H00001908-M01
ELISA Endothelin-3 Antibody (2A6-2A4)
Western Blot Endothelin-3 Antibody (2A6-2A4)
Immunoprecipitation Endothelin-3 Antibody (2A6-2A4)
(2 Publications)
Species: Hu
Applications: ELISA, IP, WB
SOX9 Antibody
[Unconjugated]
AF3075
Immunocytochemistry SOX9 Antibody [Unconjugated]
Western Blot SOX9 Antibody [Unconjugated]
Immunocytochemistry SOX9 Antibody [Unconjugated]
(2 Reviews)
(154 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
EGR2 Antibody -
BSA Free
NB110-59723
Immunocytochemistry/ Immunofluorescence EGR2 Antibody - BSA Free
Immunohistochemistry-Paraffin EGR2 Antibody - BSA Free
Western Blot EGR2 Antibody - BSA Free
(1 Review)
(3 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Ret Antibody
[Unconjugated]
AF482
Immunohistochemistry Ret Antibody [Unconjugated]
Western Blot Ret Antibody [Unconjugated]
Immunohistochemistry Ret Antibody [Unconjugated]
(40 Publications)
Species: Mu
Applications: IHC, WB
Olig2 Antibody
[Unconjugated]
AF2418
Chromatin Immunoprecipitation (ChIP) Olig2 Antibody [Unconjugated]
Immunocytochemistry Olig2 Antibody [Unconjugated]
Immunohistochemistry Olig2 Antibody [Unconjugated]
(2 Reviews)
(198 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ICC, IHC, WB
MBP Antibody (12)
NB600-717
Immunohistochemistry-Frozen MBP Antibody (12)
Immunohistochemistry-Frozen MBP Antibody (12)
Immunocytochemistry/ Immunofluorescence MBP Antibody (12)
(3 Reviews)
(42 Publications)
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Myelin Protein
Zero Antibody
NB100-1607
Immunohistochemistry Myelin Protein Zero Antibody
Immunocytochemistry/ Immunofluorescence Myelin Protein Zero Antibody
(16 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
SOX8 Antibody
NBP3-12898
Western Blot SOX8 Antibody
Immunohistochemistry-Paraffin SOX8 Antibody
Immunocytochemistry/ Immunofluorescence SOX8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
GDNF [Unconjugated]
212-GD
Bioactivity GDNF [Unconjugated]
SDS-PAGE GDNF [Unconjugated]
SEC-MALS GDNF [Unconjugated]
(217 Publications)
Species: Hu
Applications: Bind, BA
Slug Antibody
(OTI1A6)
NBP2-03886
Flow Cytometry Slug Antibody (OTI1A6)
Western Blot Slug Antibody (OTI1A6)
Immunohistochemistry-Paraffin Slug Antibody (OTI1A6)
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
OCT6 Antibody
NBP3-13349
Western Blot OCT6 Antibody
Immunohistochemistry-Paraffin OCT6 Antibody
Immunocytochemistry/ Immunofluorescence OCT6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
SRY Antibody (1G4)
- BSA Free
NBP2-37463
ELISA SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Western Blot SRY Antibody (1G4) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Recombinant Human
SOX10 GST (N-Term) Pr ...
H00006663-Q01
Recombinant Human SOX10 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for SOX10 Partial Recombinant Protein (H00006663-Q01) (0)

There are no publications for SOX10 Partial Recombinant Protein (H00006663-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX10 Partial Recombinant Protein (H00006663-Q01) (0)

There are no reviews for SOX10 Partial Recombinant Protein (H00006663-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX10 Partial Recombinant Protein (H00006663-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOX10 Products

Blogs on SOX10

There are no specific blogs for SOX10, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

SOX10 was detected in immersion fixed BG01V human embryonic stem cells differentiated to neural crest stem cells using Goat Anti-Human SOX10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2864) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
SOX10 Antibody [Unconjugated]
AF2864
A172 human glioblastoma cell line were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Olig2/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human/Mouse/Rat Olig2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2418) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The p21 promoter was detected by standard PCR.
Olig2 Antibody [Unconjugated]
AF2418

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SOX10 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SOX10