Reactivity | HuSpecies Glossary |
Applications | WB, ELISA |
Clone | 8J8E6 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human SOAT1 (NP_003092.4). Sequence: MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEK |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | SOAT1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Theoretical MW | 65 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative | 0.05% Proclin 300 |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SOAT1 Antibody (NBP3-33418)Find related products by research area.
|
Using a STAT3 antibody in chromatin immunoprecipitation (ChIP) Signal transducer and activator of transcription 3 (STAT3) is an important oncogenic transcriptional factor that mediates tumor induced immune suppression. Specifically, STAT3 transmits signals from cytokines and growth factor receptors in the pla... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SOAT1 |