![Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in Raw 264.7.](http://images.novusbio.com/fullsize/SNF5-Antibody-3E10-Western-Blot-H00006598-M01-img0012.jpg "Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in Raw 264.7.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 3E10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SMARCB1 (NP_003064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA |
| Specificity | SMARCB1 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SMARCB1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SNF5 Antibody (H00006598-M01)Find related products by research area.
|
|
You can't be without me - SNF5 The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SNF5 Antibody (3E10) [H00006598-M01] - Analysis of monoclonal antibody to SMARCB1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/SNF5-Antibody-3E10-Immunohistochemistry-Paraffin-H00006598-M01-img0008.jpg "Immunohistochemistry-Paraffin: SNF5 Antibody (3E10) [H00006598-M01] - Analysis of monoclonal antibody to SMARCB1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.")
![Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10 Analysis of SMARCB1 expression in PC-12.](http://images.novusbio.com/fullsize/SNF5-Antibody-3E10-Western-Blot-H00006598-M01-img0010.jpg "Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10 Analysis of SMARCB1 expression in PC-12.")
![Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in Hela S3 NE.](http://images.novusbio.com/fullsize/SNF5-Antibody-3E10-Western-Blot-H00006598-M01-img0011.jpg "Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in Hela S3 NE.")
![Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in NIH/3T3.](http://images.novusbio.com/fullsize/SNF5-Antibody-3E10-Western-Blot-H00006598-M01-img0013.jpg "Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in NIH/3T3.")
![ELISA: SNF5 Antibody (3E10) [H00006598-M01] - Detection limit for recombinant GST tagged SMARCB1 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SNF5-Antibody-3E10-ELISA-H00006598-M01-img0014.jpg "ELISA: SNF5 Antibody (3E10) [H00006598-M01] - Detection limit for recombinant GST tagged SMARCB1 is approximately 0.03ng/ml as a capture antibody.")
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")