Home » Proteasome subunit beta type 4 » Proteasome subunit beta type 4 Antibodies » Proteasome subunit beta type 4 Antibody

Proteasome subunit beta type 4 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Proteasome subunit beta type 4 Antibody [NBP3-38174] - Western blot analysis of various lysates using Proteasome subunit beta type 4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
Western Blot: Proteasome subunit beta type 4 Antibody [NBP3-38174] - Western blot analysis of various lysates using Proteasome subunit beta type 4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals offers 100% Guarantee

Proteasome subunit beta type 4 Antibody Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human Proteasome subunit beta type 4 (NP_002787.2).

Sequence:
MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMB4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500 - 1:2000
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Proteasome subunit beta type 4 Antibody

  • EC 3.4.25.1
  • HN3
  • HsBPROS26
  • HsN3
  • Macropain beta chain
  • Multicatalytic endopeptidase complex beta chain
  • PROS26
  • PROS-26
  • PROS26PROS-26
  • proteasome (prosome, macropain) subunit, beta type, 4
  • Proteasome beta chain
  • Proteasome chain 3
  • Proteasome subunit beta type 4
  • proteasome subunit beta type-4
  • proteasome subunit HsN3
  • proteasome subunit, beta type, 4,26 kDa prosomal protein
  • PSMB4

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GARS Antibody
NBP3-35329
Western Blot GARS Antibody
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Smad1 Antibody
[Unconjugated]
AF2039
Immunohistochemistry Smad1 Antibody [Unconjugated]
Western Blot Smad1 Antibody [Unconjugated]
Simple Western Smad1 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
BMP-2
[Unconjugated]
355-BM
Bioactivity BMP-2 [Unconjugated]
(191 Publications)
Species: Hu, Mu, Rt
Applications: BA
PRP19 Antibody
NBP3-35253
Immunohistochemistry PRP19 Antibody
Immunohistochemistry PRP19 Antibody
Immunohistochemistry PRP19 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Nuclear Factor
Erythroid 2 Related F ...
NBP2-93792
Immunocytochemistry/ Immunofluorescence Nuclear Factor Erythroid 2 Related Factor 1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Nuclear Factor Erythroid 2 Related Factor 1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Nuclear Factor Erythroid 2 Related Factor 1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western PAG1 Antibody (504004) [Unconjugated]
Western Blot PAG1 Antibody (504004) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
c-Rel Antibody
[Unconjugated]
AF2699
Simple Western c-Rel Antibody [Unconjugated]
Western Blot c-Rel Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Mu
Applications: Simple Western, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot Opsin 1 (Long Wave) Antibody
Species: Hu, Mu
Applications: WB
HN1 Antibody
NBP1-32510
ELISA HN1 Antibody
ELISA HN1 Antibody
Western Blot HN1 Antibody
Species: Hu
Applications: ELISA, IHC, IHC-P, KO, WB
Drosha Antibody
NBP1-03349
Immunoprecipitation Drosha Antibody
Western Blot Drosha Antibody
(3 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
SNIP1 Antibody
NBP1-89428
Immunocytochemistry/ Immunofluorescence SNIP1 Antibody
Immunohistochemistry-Paraffin SNIP1 Antibody
Immunohistochemistry-Paraffin SNIP1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MCG10 Antibody -
BSA Free
NBP1-76729
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
Western Blot MCG10 Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
CBP/KAT3A Antibody
(257003) [Unconjugate ...
MAB2676
Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]
Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
PSMB5 Antibody
NBP2-13820
Immunohistochemistry-Paraffin PSMB5 Antibody
Immunohistochemistry-Paraffin PSMB5 Antibody
Immunohistochemistry-Paraffin PSMB5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
Flow Cytometry KAT3B/p300 Antibody (RW105) - BSA Free
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
(14 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Cathepsin B
Antibody [Unconjugate
AF965
Immunohistochemistry Cathepsin B Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]
(1 Review)
(51 Publications)
Species: Mu
Applications: IHC, Neut, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Notch-1 Antibody
(mN1A) - BSA Free
NB100-78486
Immunohistochemistry-Paraffin Notch-1 Antibody (mN1A) - BSA Free
Western Blot Notch-1 Antibody (mN1A) - BSA Free
Flow Cytometry Notch-1 Antibody (mN1A) - BSA Free
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Proteasome subunit
beta type 4 Antibody
NBP3-38174
Proteasome subunit beta type 4 Antibody
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for Proteasome subunit beta type 4 Antibody (NBP3-38174) (0)

There are no publications for Proteasome subunit beta type 4 Antibody (NBP3-38174).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Proteasome subunit beta type 4 Antibody (NBP3-38174) (0)

There are no reviews for Proteasome subunit beta type 4 Antibody (NBP3-38174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome subunit beta type 4 Antibody (NBP3-38174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome subunit beta type 4 Products

Research Areas for Proteasome subunit beta type 4 Antibody (NBP3-38174)

Find related products by research area.

Blogs on Proteasome subunit beta type 4

There are no specific blogs for Proteasome subunit beta type 4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome subunit beta type 4 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PSMB4