![Western Blot: Proteasome 20S beta2 Antibody [NBP1-92294] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/Proteasome-20S-beta2-Antibody-Western-Blot-NBP1-92294-img0006.jpg "Western Blot: Proteasome 20S beta2 Antibody [NBP1-92294] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PSMB2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-92294 | Applications | Species |
|---|---|---|
| Ramachandran KV, Margolis SS. A mammalian nervous-system-specific plasma membrane proteasome complex that modulates neuronal function. Nat. Struct. Mol. Biol. 2017-03-13 [PMID: 28287632] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PSMB2 |
![Immunocytochemistry/Immunofluorescence: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Proteasome-20S-beta2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92294-img0007.jpg "Immunocytochemistry/Immunofluorescence: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Proteasome-20S-beta2-Antibody-Immunohistochemistry-Paraffin-NBP1-92294-img0012.jpg "Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.")
![Western Blot: Proteasome 20S beta2 Antibody [NBP1-92294] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/Proteasome-20S-beta2-Antibody-Western-Blot-NBP1-92294-img0005.jpg "Western Blot: Proteasome 20S beta2 Antibody [NBP1-92294] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human kidney shows moderate to strong nuclear and cytoplasmic positivity in cells in tubules](http://images.novusbio.com/fullsize/Proteasome-20S-beta2-Antibody-Immunohistochemistry-Paraffin-NBP1-92294-img0009.jpg "Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human kidney shows moderate to strong nuclear and cytoplasmic positivity in cells in tubules")
![Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human placenta shows moderate to strong nuclear and cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Proteasome-20S-beta2-Antibody-Immunohistochemistry-Paraffin-NBP1-92294-img0010.jpg "Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human placenta shows moderate to strong nuclear and cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human colon shows strong cytoplasmic positivity in glandular cells](http://images.novusbio.com/fullsize/Proteasome-20S-beta2-Antibody-Immunohistochemistry-Paraffin-NBP1-92294-img0011.jpg "Immunohistochemistry-Paraffin: Proteasome 20S beta2 Antibody [NBP1-92294] - Staining of human colon shows strong cytoplasmic positivity in glandular cells")
![Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Simple_Western_17147.jpg)
![Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Western_Blot_13068.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")