![Western Blot: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdown. Protein levels of GMF-beta in human glial cell line (HEB) and human glioma cell lines of the different grades (CHG5, SHG44, U87). Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/abstract/5509), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/GMF-beta-Antibody-Western-Blot-NBP1-89755-img0022.jpg "Western Blot: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdown. Protein levels of GMF-beta in human glial cell line (HEB) and human glioma cell lines of the different grades (CHG5, SHG44, U87). Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/abstract/5509), licensed under a CC-BY license.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GMFB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 17 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GMF-beta Antibody (NBP1-89755)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: GMF-beta Antibody [NBP1-89755] - GMF-beta is involved in neovasculogenesis in human glioblastoma. A. Co-expression of GMF-beta and CD31 in several tumor cells. B. The GMF-beta+/CD31+ incomplete microvessel-like structure in hypovascular zones. C. GMF-beta+/CD31+ immature microvessel in hypovascular zones. D. Single GMF-beta+/CD31+ mature microvessel in vascularized areas. E. GMF-beta-/CD31+ mature microvessels in vascularized areas. Red arrows denote GMF-beta staining, black arrows indicate CD31 staining. Scale bar: 50 um. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/abstract/5509), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/GMF-beta-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89755-img0020.jpg "Immunocytochemistry/Immunofluorescence: GMF-beta Antibody [NBP1-89755] - GMF-beta is involved in neovasculogenesis in human glioblastoma. A. Co-expression of GMF-beta and CD31 in several tumor cells. B. The GMF-beta+/CD31+ incomplete microvessel-like structure in hypovascular zones. C. GMF-beta+/CD31+ immature microvessel in hypovascular zones. D. Single GMF-beta+/CD31+ mature microvessel in vascularized areas. E. GMF-beta-/CD31+ mature microvessels in vascularized areas. Red arrows denote GMF-beta staining, black arrows indicate CD31 staining. Scale bar: 50 um. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/abstract/5509), licensed under a CC-BY license.")
![Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - GMF-beta expression is positively associated with tumor grade and microvessel density (MVD) in human glioma. Distributions of GMF-beta in normal brain tissue (left panel), low-grade (middle panel) and high-grade glioma (right panel). Solid arrows, GMF-beta staining (brown); open arrows, negative staining; Scale bar: 50 um. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/abstract/5509), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/GMF-beta-Antibody-Immunohistochemistry-NBP1-89755-img0019.jpg "Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - GMF-beta expression is positively associated with tumor grade and microvessel density (MVD) in human glioma. Distributions of GMF-beta in normal brain tissue (left panel), low-grade (middle panel) and high-grade glioma (right panel). Solid arrows, GMF-beta staining (brown); open arrows, negative staining; Scale bar: 50 um. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/abstract/5509), licensed under a CC-BY license.")
![Western Blot: GMF-beta Antibody [NBP1-89755] - Analysis in human cell line A-431.](http://images.novusbio.com/fullsize/GMF-beta-Antibody-Western-Blot-NBP1-89755-img0013.jpg "Western Blot: GMF-beta Antibody [NBP1-89755] - Analysis in human cell line A-431.")
![Western Blot: GMF-beta Antibody [NBP1-89755] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/GMF-beta-Antibody-Western-Blot-NBP1-89755-img0014.jpg "Western Blot: GMF-beta Antibody [NBP1-89755] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry/Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/GMF-beta-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89755-img0015.jpg "Immunocytochemistry/Immunofluorescence: GMF-beta Antibody [NBP1-89755] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: GMF-beta Antibody [NBP1-89755] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/GMF-beta-Antibody-Immunohistochemistry-Paraffin-NBP1-89755-img0017.jpg "Immunohistochemistry-Paraffin: GMF-beta Antibody [NBP1-89755] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.")
![Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - Staining of mouse somatosensory cortex shows immunoreactivity in neuronal cell bodies and dendrites.](http://images.novusbio.com/fullsize/GMF-beta-Antibody-Immunohistochemistry-NBP1-89755-img0005.jpg "Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - Staining of mouse somatosensory cortex shows immunoreactivity in neuronal cell bodies and dendrites.")
![Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - Staining of mouse cerebellum shows strong positivity in Purkinje cells.](http://images.novusbio.com/fullsize/GMF-beta-Antibody-Immunohistochemistry-NBP1-89755-img0009.jpg "Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - Staining of mouse cerebellum shows strong positivity in Purkinje cells.")
![Knockdown Validated: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdown. Assessment of GMF-beta knockdown in U87 cells by western blotting. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/abstract/5509), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/GMF-beta-Antibody-Knockdown-Validated-NBP1-89755-img0021.jpg "Knockdown Validated: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdown. Assessment of GMF-beta knockdown in U87 cells by western blotting. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/abstract/5509), licensed under a CC-BY license.")
![Western Blot: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdownA. Protein levels of GMF-beta in human glial cell line (HEB) & human glioma cell lines of the different grades (CHG5, SHG44, U87). B. Assessment of GMF-beta knockdown in U87 cells by western blotting. C. Tube formation by U87 mock cells (left panel); impaired tube formation by U87-shGMF-beta cells (right panel). Inspection under a phase contrast fluorescent microscope (× 100). D. Quantified tubulogenesis of U87 mock cells & U87-shGMF-beta cells by pattern recognition system (left panel) & branch point counting system (right panel).*** indicates significant difference with P < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26515590), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89755_rabbit-polyclonal-gmf-beta-antibody-310202415371963.jpg "Western Blot: GMF-beta Antibody [NBP1-89755] - Tubulogenesis of human U87 glioblastoma cells is inhibited by GMF-beta knockdownA. Protein levels of GMF-beta in human glial cell line (HEB) & human glioma cell lines of the different grades (CHG5, SHG44, U87). B. Assessment of GMF-beta knockdown in U87 cells by western blotting. C. Tube formation by U87 mock cells (left panel); impaired tube formation by U87-shGMF-beta cells (right panel). Inspection under a phase contrast fluorescent microscope (× 100). D. Quantified tubulogenesis of U87 mock cells & U87-shGMF-beta cells by pattern recognition system (left panel) & branch point counting system (right panel).*** indicates significant difference with P < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26515590), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - GMF-beta knockdown suppresses tumor growth & the formation of human-CD31 positive microvessels (hCD31-MVs) in orthotopic U87 xenograft modelsA. The cross-sectional appearance of xenografted gliomas from U87-mock group B. The cross-sectional appearance of xenografted gliomas from U87-shGMF-beta group. Gross tumor boundaries were delineated by white dotlines. C. A hCD31-microvessel & several hCD31-negative vessels in U87-mock tumor. D. No hCD31-MVs, only hCD31-negative vessels in U87-shGMF-beta tumor. Red solid arrows indicate hGMF-beta staining in tumor cells, black solid arrows show hCD31 staining on microvasular endothelia, & open arrows denote vessels negative for hCD31. Scale bar: 100 μm in upper pannels; 50 μm in lower pannels. E. Quantitative comparisons of gross tumor volume between U87-mock & U87-shGMF-beta group. F. Quantitative comparisons of hCD31-microvessel densities (MVDs) between U87-mock & U87-shGMF-beta group. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26515590), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89755_rabbit-polyclonal-gmf-beta-antibody-310202416121977.jpg "Immunohistochemistry: GMF-beta Antibody [NBP1-89755] - GMF-beta knockdown suppresses tumor growth & the formation of human-CD31 positive microvessels (hCD31-MVs) in orthotopic U87 xenograft modelsA. The cross-sectional appearance of xenografted gliomas from U87-mock group B. The cross-sectional appearance of xenografted gliomas from U87-shGMF-beta group. Gross tumor boundaries were delineated by white dotlines. C. A hCD31-microvessel & several hCD31-negative vessels in U87-mock tumor. D. No hCD31-MVs, only hCD31-negative vessels in U87-shGMF-beta tumor. Red solid arrows indicate hGMF-beta staining in tumor cells, black solid arrows show hCD31 staining on microvasular endothelia, & open arrows denote vessels negative for hCD31. Scale bar: 100 μm in upper pannels; 50 μm in lower pannels. E. Quantitative comparisons of gross tumor volume between U87-mock & U87-shGMF-beta group. F. Quantitative comparisons of hCD31-microvessel densities (MVDs) between U87-mock & U87-shGMF-beta group. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26515590), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![SDS-PAGE beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_321.jpg)
![Bioactivity beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_322.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Simple_Western_17259.jpg)
![Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Western_Blot_14481.jpg)
![Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Immunohistochemistry_14553.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_723.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_724.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/CXCL10_DIP100_ELISA_121.jpg)
![Immunohistochemistry FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Immunohistochemistry_17183.jpg)
![Simple Western FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Simple_Western_17471.jpg)
![Western Blot FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Western_Blot_18640.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")