Home » NCOA2 » NCOA2 Proteins » NCOA2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NCOA2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NCOA2 Recombinant Protein Antigen (NBP2-55879PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NCOA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCOA2.

Source: E. coli

Amino Acid Sequence: PKLERLDSKTDPASNTKLIAMKTEKEEMSFEPGDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCOA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55879.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NCOA2 Recombinant Protein Antigen

  • bHLHe75
  • bHLHe75MGC138808
  • Class E basic helix-loop-helix protein 75
  • EC 2.3.1.48
  • GRIP1glucocorticoid receptor-interacting protein-1
  • HTIF2
  • KAT13C
  • NCOA2
  • NCoA-2SRC2
  • nuclear receptor coactivator 2
  • TIF2
  • TIF2hTIF2
  • Transcriptional intermediary factor 2

Background

Steroid and thyroid hormones and retinoic acid regulate a complex array of gene expression activity via intracellular receptor transcription factors belonging to the ligand dependent nuclear receptor superfamily. Adding to the complexity of function of these transcription factors are associated proteins known as coactivators and corepressors which, as their names suggest, enhance or depress transcriptional activity of the nuclear receptor with which they associate. One such coactivator is Steroid Receptor Coactivator-2 (SRC2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SRC1 Antibody
(1135)
NB200-310
Western Blot SRC1 Antibody (1135)
(1 Review)
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
NCOA3/AIB1 Antibody
NB100-314
Western Blot NCOA3/AIB1 Antibody
Western Blot NCOA3/AIB1 Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: IP, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
CBP/KAT3A Antibody
(257003) [Unconjugate ...
MAB2676
Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]
Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
MYBBP1A Antibody
NB100-61050
Immunohistochemistry-Paraffin MYBBP1A Antibody
Immunoprecipitation MYBBP1A Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, PLA, WB
PELP1 Antibody
NB200-331
Immunoprecipitation PELP1 Antibody
Western Blot PELP1 Antibody
Immunohistochemistry-Paraffin PELP1 Antibody
(18 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
MSH6 Antibody
NBP1-83319
Immunocytochemistry/ Immunofluorescence MSH6 Antibody
Immunohistochemistry-Paraffin MSH6 Antibody
Immunohistochemistry-Paraffin MSH6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
Flow Cytometry KAT3B/p300 Antibody (RW105) - BSA Free
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
(13 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
MCG10 Antibody -
BSA Free
NBP1-76729
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
Western Blot MCG10 Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western PAG1 Antibody (504004) [Unconjugated]
Western Blot PAG1 Antibody (504004) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot Opsin 1 (Long Wave) Antibody
Species: Hu, Mu
Applications: WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Amphiregulin
Antibody
AF262
Neutralization Amphiregulin Antibody
Immunocytochemistry Amphiregulin Antibody
Immunohistochemistry Amphiregulin Antibody
(1 Review)
(35 Publications)
Species: Hu
Applications: ICC, IHC, Neut, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin AKR1B1 Antibody
Immunohistochemistry-Paraffin AKR1B1 Antibody
Immunohistochemistry-Paraffin AKR1B1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(11 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Glutathione
Reductase Antibody
NBP2-16684
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NCOA2 Recombinant
Protein Antigen
NBP2-55879PEP
NCOA2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for NCOA2 Recombinant Protein Antigen (NBP2-55879PEP) (0)

There are no publications for NCOA2 Recombinant Protein Antigen (NBP2-55879PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA2 Recombinant Protein Antigen (NBP2-55879PEP) (0)

There are no reviews for NCOA2 Recombinant Protein Antigen (NBP2-55879PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NCOA2 Recombinant Protein Antigen (NBP2-55879PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCOA2 Products

Research Areas for NCOA2 Recombinant Protein Antigen (NBP2-55879PEP)

Find related products by research area.

Blogs on NCOA2

There are no specific blogs for NCOA2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Recombinant Human Amphiregulin (Catalog # 262‑AR) stimulates proliferation in the Balb/3T3 mouse embryonic fibroblast cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Amphiregulin (50 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Amphiregulin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF262). The ND50 is typically 0.3-1 µg/mL.
Amphiregulin Antibody
AF262
Immunohistochemistry: NCOA2 Antibody [NB100-1756] - Sample : FFPE section of prostate adenocarcinoma. Antibody : Affinity purified rabbit anti-NCOA2/SRC2 used at a dilution of 1:100. Detection : DAB
NCOA2 Antibody
NB100-1756
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - An intracellular stain was performed on Jurkat cells with GR/NR3C1 (BuGR2) antibody NB300-731PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerthrin.
GR/NR3C1 Antibody (BuGR2) - BSA Free
NB300-731

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCOA2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NCOA2