I study in HKBU and want to buy some antibodies (an anti-AKR1B1 and anti-AKR1B1). I found that there are different kinds of AKR1B1 (AR) and AKR1B10 (ARL-1) antibodies in your company. Do these antibodies cross-react with each other? Could you give me some advice about how I choose antibodies with the minimum cross-reactivity?

Name: AKR1B1 Antibody
Brand: Novus Biologicals
SKU: NBP1-89146
Price: 519 USD

Question

I study in HKBU and want to buy some antibodies (an anti-AKR1B1 and anti-AKR1B1).  I found that there are different kinds of AKR1B1 (AR) and AKR1B10 (ARL-1) antibodies in your company. Do these antibodies  cross-react with each other? Could you give me some advice about how I choose antibodies with the minimum cross-reactivity?

Accepted Answer

Here is a link to our antibodies to AKR1B1. The cross-reactivity of these against AKR1B10 is not given and so I ran alignments against the AKR1B10 sequence for you in the instances where the immunogen sequence was disclosed. In all of these cases the homology was greater than 90%, so you would be likely to see cross-reactivity with the AKR1B10 protein. I also ran an alignment between the full length sequences of AKR1B1 and AKR1B10 and found that the homology between these two proteins is 70%. Please see this link for our  AKR1B10 primary antibodies. Of these, the immunogen used to generate NBP1-44998 is listed as a highly specific 15 amino acid portion of human AKR1B10 (within amino acids 100-150). [UniProt# O60218]. This may be a suitable choice for you when detecting AKR1B10.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	ICC/IF, IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	AKR1B1
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified

AKR1B1 Antibody

Species Glossary

Images

Product Details

Order Details

AKR1B1 Antibody Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Alternate Names for AKR1B1 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for AKR1B1 Antibody (NBP1-89146) (0)

Reviews for AKR1B1 Antibody (NBP1-89146) (0)

Product General Protocols

Video Protocols

FAQs for AKR1B1 Antibody (NBP1-89146). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional AKR1B1 Products

Research Areas for AKR1B1 Antibody (NBP1-89146)

Blogs on AKR1B1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics