| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 3B7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | PLAG1 (NP_002646, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PLAG1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. IHC usage was reported in scientific literature. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Western_Blot_20725.jpg)
![Simple Western NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Simple_Western_20928.jpg)
![Immunocytochemistry NCAM-1/CD56 Antibody [Unconjugated]](https://images.novusbio.com/images2/NCAM1_AF2408_Immunocytochemistry_16574.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PLAG1 Antibody (H00005324-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: PLAG1 Antibody (3B7) [H00005324-M02] - Detection of the FGFR1-PLAG1 & TGFBR3-PLAG1 fusion genes. a Illustration of the FGFR1-PLAG1 fusion gene. Arrows show locations of genomic break points for each of the tumors. b Expression of PLAG1 (left) & FGFR1 (right) in PLAG1 fusion-negative vs. FGFR1-PLAG1-positive tumors. Graphs show fragments per kilobase of exon per million fragments mapped (FPKM), based on RNA-seq data. ****P < 0.0001; Student’s t-test. n = 19 + 7. Horizontal lines show mean values. c Illustration of the TGFBR3-PLAG1 fusion gene. d Expression (FPKM) of PLAG1 (left) & TGFBR3 (right) in PLAG1 fusion-negative vs. TGFBR3-PLAG1-positive tumors. ***P < 0.001, ****P < 0.0001; Student’s t-test. n = 19 + 5. Horizontal lines show mean values. e Left, IHC showing TGFBR3 staining in whole tumor sections (upper panels, scale bars=5 mm) & enlargement of selected areas (lower panels, scale bars=100 μm). Right, quantification of IHC TGFBR3 levels in TGFBR3-PLAG1 positive vs. negative tumors. P (high TGFBR3) = 0.002, Fisher’s exact test. n = 5 + 34. f Poisson sample clustering based on gene expression in cohort 1, annotated by TGFBR3 IHC results Image collected & cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-01178-z), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00005324-m02_mouse-monoclonal-plag1-antibody-3b7-310202415485128.jpg "Immunohistochemistry: PLAG1 Antibody (3B7) [H00005324-M02] - Detection of the FGFR1-PLAG1 & TGFBR3-PLAG1 fusion genes. a Illustration of the FGFR1-PLAG1 fusion gene. Arrows show locations of genomic break points for each of the tumors. b Expression of PLAG1 (left) & FGFR1 (right) in PLAG1 fusion-negative vs. FGFR1-PLAG1-positive tumors. Graphs show fragments per kilobase of exon per million fragments mapped (FPKM), based on RNA-seq data. ****P < 0.0001; Student’s t-test. n = 19 + 7. Horizontal lines show mean values. c Illustration of the TGFBR3-PLAG1 fusion gene. d Expression (FPKM) of PLAG1 (left) & TGFBR3 (right) in PLAG1 fusion-negative vs. TGFBR3-PLAG1-positive tumors. ***P < 0.001, ****P < 0.0001; Student’s t-test. n = 19 + 5. Horizontal lines show mean values. e Left, IHC showing TGFBR3 staining in whole tumor sections (upper panels, scale bars=5 mm) & enlargement of selected areas (lower panels, scale bars=100 μm). Right, quantification of IHC TGFBR3 levels in TGFBR3-PLAG1 positive vs. negative tumors. P (high TGFBR3) = 0.002, Fisher’s exact test. n = 5 + 34. f Poisson sample clustering based on gene expression in cohort 1, annotated by TGFBR3 IHC results Image collected & cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-01178-z), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
