![Western Blot: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis using Anti-ADH6 antibody NBP2-62658 (A) shows similar pattern to independent antibody NBP2-62661 (B).](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-6-Antibody-Western-Blot-NBP2-62658-img0006.jpg "Western Blot: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis using Anti-ADH6 antibody NBP2-62658 (A) shows similar pattern to independent antibody NBP2-62661 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADH6 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for alcohol dehydrogenase 6 Antibody (NBP2-62658)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADH6 |
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human testis.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-6-Antibody-Immunohistochemistry-Paraffin-NBP2-62658-img0010.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human testis.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis in human liver and pancreas tissues using Anti-ADH6 antibody. Corresponding ADH6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-6-Antibody-Immunohistochemistry-Paraffin-NBP2-62658-img0001.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Analysis in human liver and pancreas tissues using Anti-ADH6 antibody. Corresponding ADH6 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human liver shows high expression.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-6-Antibody-Immunohistochemistry-Paraffin-NBP2-62658-img0002.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human liver shows high expression.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-6-Antibody-Immunohistochemistry-Paraffin-NBP2-62658-img0003.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human colon, kidney, liver and testis using Anti-ADH6 antibody NBP2-62658 (A) shows similar protein distribution across tissues to independent antibody NBP2-62661 (B).](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-6-Antibody-Immunohistochemistry-Paraffin-NBP2-62658-img0005.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human colon, kidney, liver and testis using Anti-ADH6 antibody NBP2-62658 (A) shows similar protein distribution across tissues to independent antibody NBP2-62661 (B).")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human colon.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-6-Antibody-Immunohistochemistry-Paraffin-NBP2-62658-img0007.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human colon.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-6-Antibody-Immunohistochemistry-Paraffin-NBP2-62658-img0008.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human kidney.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-6-Antibody-Immunohistochemistry-Paraffin-NBP2-62658-img0009.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 6 Antibody [NBP2-62658] - Staining of human kidney.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")