Home » Aldo-keto Reductase 1B10/AKR1B10 » Aldo-keto Reductase 1B10/AKR1B10 Antibodies » Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)
Novus Biologicals products are now on bio-techne.com

Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)

 (14 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - AKR1B10 monoclonal antibody (M01), clone 1A6 Analysis of AKR1B10 expression in HepG2.
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - AKR1B10 monoclonal antibody (M01), clone 1A6 Analysis of AKR1B10 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of AKR1B10 expression in transfected 293T cell line by AKR1B10 monoclonal antibody (M01), clone 1A6.Lane 1: AKR1B10 transfected ...read more
ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.1ng/ml as a capture antibody.
Sandwich ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
1A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) Summary

Immunogen
AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
Specificity
AKR1B10 - aldo-keto reductase family 1, member B10 (aldose reductase)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AKR1B10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00057016-M01 in the following applications:

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)

  • AKR1B10
  • AKR1B11
  • AKR1B12
  • Aldo-keto Reductase 1B10
  • aldo-keto reductase family 1 member B10
  • aldo-keto reductase family 1, member B10 (aldose reductase)
  • aldo-keto reductase family 1, member B11 (aldose reductase-like)
  • AldoketoReductase 1B10
  • aldose reductase-like 1
  • aldose reductase-like peptide
  • Aldose reductase-like
  • Aldose reductase-related protein
  • ALDRLn
  • ARL1
  • ARL-1SI reductase
  • ARP
  • EC 1.1.1
  • EC 1.1.1.-
  • EC 1.1.1.21
  • hARP
  • HIS
  • HSI
  • MGC14103
  • Small intestine reductase

Background

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot ACTR2 Antibody (1B10-C4)
Immunohistochemistry-Paraffin ACTR2 Antibody (1B10-C4)
Sandwich ELISA ACTR2 Antibody (1B10-C4)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AKR1A1 Antibody
(OTI6E3)
NBP2-02164
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Flow Cytometry AKR1A1 Antibody (OTI6E3)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
alcohol
dehydrogenase 4 Antib
NBP1-90233
Immunohistochemistry-Paraffin alcohol dehydrogenase 4 Antibody
Immunohistochemistry-Paraffin alcohol dehydrogenase 4 Antibody
Immunohistochemistry-Paraffin alcohol dehydrogenase 4 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
alcohol
dehydrogenase 1C Anti ...
NBP2-92824
Immunohistochemistry-Paraffin alcohol dehydrogenase 1C Antibody - BSA Free
Western Blot alcohol dehydrogenase 1C Antibody - BSA Free
Immunohistochemistry-Paraffin alcohol dehydrogenase 1C Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
alcohol
dehydrogenase 1B Anti ...
NBP2-00649
Western Blot alcohol dehydrogenase 1B Antibody (OTI4F12)
Flow Cytometry alcohol dehydrogenase 1B Antibody (OTI4F12)
Flow Cytometry alcohol dehydrogenase 1B Antibody (OTI4F12)
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
alcohol
dehydrogenase Antibod
NB300-956
Western Blot alcohol dehydrogenase Antibody
Western Blot alcohol dehydrogenase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
alcohol
dehydrogenase 6 Antib
NBP2-62658
Immunohistochemistry-Paraffin alcohol dehydrogenase 6 Antibody
Immunohistochemistry-Paraffin alcohol dehydrogenase 6 Antibody
Immunohistochemistry-Paraffin alcohol dehydrogenase 6 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
ACTR3 Antibody
(8K4F2)
NBP3-16424
Immunohistochemistry-Paraffin ACTR3 Antibody (8K4F2)
Immunohistochemistry-Paraffin ACTR3 Antibody (8K4F2)
Immunohistochemistry-Paraffin ACTR3 Antibody (8K4F2)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin AKR1B1 Antibody
Immunohistochemistry-Paraffin AKR1B1 Antibody
Immunohistochemistry-Paraffin AKR1B1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AICDA Antibody
NBP1-30955
Immunocytochemistry/ Immunofluorescence AICDA Antibody
Immunohistochemistry-Paraffin AICDA Antibody
Western Blot AICDA Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Angiopoietin-like
Protein 2/ANGPTL2 Ant ...
AF1444
Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: IHC, WB
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Pleiotrophin/PTN
Antibody [Unconjugate ...
AF-252-PB
Immunohistochemistry Pleiotrophin/PTN Antibody [Unconjugated]
(21 Publications)
Species: Hu
Applications: IHC, WB
N-WASP Antibody
NBP1-82512
Immunocytochemistry/ Immunofluorescence N-WASP Antibody
Immunohistochemistry-Paraffin N-WASP Antibody
Immunohistochemistry-Paraffin N-WASP Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
ARFRP1 Antibody
NBP2-14306
Western Blot ARFRP1 Antibody
Immunohistochemistry-Paraffin ARFRP1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
APOBEC3A Antibody
NBP2-82648
Western Blot APOBEC3A Antibody
Species: Hu
Applications: WB
Cortactin Antibody
NBP2-15971
Western Blot Cortactin Antibody
Western Blot Cortactin Antibody
Immunohistochemistry-Paraffin Cortactin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Aldo-keto
Reductase 1B10/AKR1B1 ...
H00057016-M01
Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC

Publications for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)(14)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 10 of 14. Show All 14 Publications.
Publications using H00057016-M01 Applications Species
Miika M, Terhi A, Sara K et al. A novel uterine leiomyoma subtype exhibits NRF2 activation and mutations in genes associated with neddylation of the Cullin 3-RING E3 ligase. Oncogenesis. 2022-09-07 [PMID: 36068196]
Kitakaze T, Makiyama A, Samukawa Y et al. A physiological concentration of luteolin induces phase II drug-metabolizing enzymes through the ERK1/2 signaling pathway in HepG2 cells. Arch Biochem Biophys. 2019-04-02 [PMID: 30641047]
Park SH, Kim JH, Ko E et al. Resistance to gefitinib and cross-resistance to irreversible EGFR-TKIs mediated by disruption of the Keap1-Nrf2 pathway in human lung cancer cells. FASEB J 2018-05-29 [PMID: 29812969]
Connor JP, Esbona K, Matkowskyj KA. et al. AKR1B10 Expression by Immunohistochemistry in Surgical Resections and Fine Needle Aspiration Cytology Material in Patients with Cystic Pancreatic Lesions; Potential for Improved Non-Operative Diagnosis. Hum Pathol 2017-10-24 [PMID: 29079172]
Berard AR, Coombs KM, Severini A. Quantification of the Host Response Proteome after Herpes Simplex 1 Virus infection. J Proteome Res. 2015-04-15 [PMID: 25815715]
Matkowskyj KA, Bai H, Liao J et al. Aldo-Ketoreductase Family 1 B10 (AKR1B10) as A Biomarker to Distinguish Hepatocellular Carcinoma from Benign Liver Lesions. Human Pathology(2013). 2014-04-01 [PMID: 24656094]
Nelson AC, Pillay N, Henderson S et al. An integrated functional genomics approach identifies the regulatory network directed by brachyury (T) in chordoma. J Pathol. 2012-07-30 [PMID: 22847733]
Moriguchi H, Zhang Y, Mihara M, Sato C. A therapeutic method for the direct reprogramming of human liver cancer cells with only chemicals. Sci Rep. 2012-02-21 [PMID: 22355790]
Chung YT, Matkowskyj KA, Li H et al. Overexpression and oncogenic function of aldo-keto reductase family 1B10 (AKR1B10) in pancreatic carcinoma. Mod Pathol. 2012-01-06 [PMID: 22222635]
Schmitz KJ, Sotiropoulos GC, Baba HA et al. AKR1B10 expression is associated with less aggressive hepatocellular carcinoma: a clinicopathological study of 168 cases. Liver International. 2011-03-29 [PMID: 21645211]
Show All 14 Publications.

Reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01) (0)

There are no reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aldo-keto Reductase 1B10/AKR1B10 Products

Research Areas for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)

Find related products by research area.

Blogs on Aldo-keto Reductase 1B10/AKR1B10

There are no specific blogs for Aldo-keto Reductase 1B10/AKR1B10, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) and receive a gift card or discount.


Bioinformatics

Gene Symbol AKR1B10
Entrez
OMIM
Uniprot