![Western Blot: ACTR3 Antibody (8K4F2) [NBP3-16424] - Western blot analysis of extracts of various cell lines, using ACTR3 Rabbit mAb (NBP3-16424) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.](http://images.novusbio.com/fullsize/ACTR3-Antibody-8K4F2-Western-Blot-NBP3-16424-img0007.jpg "Western Blot: ACTR3 Antibody (8K4F2) [NBP3-16424] - Western blot analysis of extracts of various cell lines, using ACTR3 Rabbit mAb (NBP3-16424) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | 8K4F2 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 319-418 of human ACTR3 (P61158). IVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | ACTR3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACTR3 Antibody (NBP3-16424)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ACTR3 |
![Immunocytochemistry/Immunofluorescence: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunofluorescence analysis of U-2 OS cells using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ACTR3-Antibody-8K4F2-Immunocytochemistry-Immunofluorescence-NBP3-16424-img0006.jpg "Immunocytochemistry/Immunofluorescence: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunofluorescence analysis of U-2 OS cells using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunohistochemistry of paraffin-embedded mouse spleen using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ACTR3-Antibody-8K4F2-Immunohistochemistry-Paraffin-NBP3-16424-img0003.jpg "Immunohistochemistry-Paraffin: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunohistochemistry of paraffin-embedded mouse spleen using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunofluorescence analysis of C6 cells using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ACTR3-Antibody-8K4F2-Immunocytochemistry-Immunofluorescence-NBP3-16424-img0004.jpg "Immunocytochemistry/Immunofluorescence: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunofluorescence analysis of C6 cells using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunofluorescence analysis of NIH-3T3 cells using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ACTR3-Antibody-8K4F2-Immunocytochemistry-Immunofluorescence-NBP3-16424-img0005.jpg "Immunocytochemistry/Immunofluorescence: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunofluorescence analysis of NIH-3T3 cells using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunohistochemistry of paraffin-embedded rat kidney using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ACTR3-Antibody-8K4F2-Immunohistochemistry-Paraffin-NBP3-16424-img0001.jpg "Immunohistochemistry-Paraffin: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunohistochemistry of paraffin-embedded rat kidney using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunohistochemistry of paraffin-embedded human appendix using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/ACTR3-Antibody-8K4F2-Immunohistochemistry-Paraffin-NBP3-16424-img0002.jpg "Immunohistochemistry-Paraffin: ACTR3 Antibody (8K4F2) [NBP3-16424] - Immunohistochemistry of paraffin-embedded human appendix using ACTR3 Rabbit mAb (NBP3-16424) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Western_Blot_16494.jpg)
![Immunohistochemistry CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Immunohistochemistry_16666.jpg)
![Neutralization CRISP-1 Antibody (840017) [Unconjugated]](https://images.novusbio.com/images2/CRISP1_MAB4675_Block_Neutralize_16780.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Simple_Western_17259.jpg)
![Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Western_Blot_14481.jpg)
![Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Immunohistochemistry_14553.jpg)
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")