![Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining in human liver and pancreas tissues using anti-ADH4 antibody. Corresponding ADH4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-4-Antibody-Immunohistochemistry-Paraffin-NBP1-90233-img0009.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining in human liver and pancreas tissues using anti-ADH4 antibody. Corresponding ADH4 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADH4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for alcohol dehydrogenase 4 Antibody (NBP1-90233)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-4-Antibody-Western-Blot-NBP1-90233-img0010.jpg "Western Blot: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Analysis in human liver tissue.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human liver shows high expression.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-4-Antibody-Immunohistochemistry-Paraffin-NBP1-90233-img0007.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human liver shows high expression.")
![Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/alcohol-dehydrogenase-4-Antibody-Immunohistochemistry-Paraffin-NBP1-90233-img0008.jpg "Immunohistochemistry-Paraffin: alcohol dehydrogenase 4 Antibody [NBP1-90233] - Staining of human pancreas shows low expression as expected.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")