![Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human fallopian tube, liver, lymph node and testis using Anti-MSH6 antibody NBP1-83319 (A) shows similar protein distribution across tissues to independent antibody NBP1-83318 (B).](http://images.novusbio.com/fullsize/MSH6-Antibody-Immunohistochemistry-Paraffin-NBP1-83319-img0014.jpg "Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human fallopian tube, liver, lymph node and testis using Anti-MSH6 antibody NBP1-83319 (A) shows similar protein distribution across tissues to independent antibody NBP1-83318 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKAREFEKMNQSLRLFREVCLASERSTV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MSH6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MSH6 Antibody (NBP1-83319)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MSH6 |
![Western Blot: MSH6 Antibody [NBP1-83319] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize/MSH6-Antibody-Western-Blot-NBP1-83319-img0005.jpg "Western Blot: MSH6 Antibody [NBP1-83319] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
![Immunocytochemistry/Immunofluorescence: MSH6 Antibody [NBP1-83319] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.](http://images.novusbio.com/fullsize/MSH6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83319-img0007.jpg "Immunocytochemistry/Immunofluorescence: MSH6 Antibody [NBP1-83319] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.")
![Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/MSH6-Antibody-Immunohistochemistry-Paraffin-NBP1-83319-img0017.jpg "Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Western Blot: MSH6 Antibody [NBP1-83319] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/MSH6-Antibody-Western-Blot-NBP1-83319-img0004.jpg "Western Blot: MSH6 Antibody [NBP1-83319] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/MSH6-Antibody-Immunohistochemistry-Paraffin-NBP1-83319-img0013.jpg "Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/MSH6-Antibody-Immunohistochemistry-Paraffin-NBP1-83319-img0015.jpg "Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/MSH6-Antibody-Immunohistochemistry-Paraffin-NBP1-83319-img0016.jpg "Immunohistochemistry-Paraffin: MSH6 Antibody [NBP1-83319] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.")
![Immunohistochemistry MMR/CD206/Mannose Receptor Antibody [Unconjugated]](https://images.novusbio.com/images2/MMR_AF2535_Immunohistochemistry_15450.jpg)
![Western Blot MMR/CD206/Mannose Receptor Antibody [Unconjugated]](https://images.novusbio.com/images2/MMR_AF2535_Western_Blot_12738.jpg)
![Immunohistochemistry MMR/CD206/Mannose Receptor Antibody [Unconjugated]](https://images.novusbio.com/images2/MMR_AF2535_Immunohistochemistry_20447.jpg)
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")