Home » Jak1 » Jak1 Peptides and Proteins » Recombinant Human Jak1 GST (N-Term) Protein

Recombinant Human Jak1 GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Jak1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 221-320 of Human Jak1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVV
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
JAK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00003716-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Jak1 GST (N-Term) Protein

  • EC 2.7.10
  • Jak1
  • JAK-1
  • JAK1Atyrosine-protein kinase JAK1
  • JAK1B
  • Janus kinase 1EC 2.7.10.2
  • JTK3

Background

JAK1 - Janus kinase 1 (a protein tyrosine kinase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry Jak2 Antibody (53B7) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak2 Antibody (53B7) - BSA Free
Western Blot Jak2 Antibody (53B7) - BSA Free
(3 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
STAT1 [p Tyr701]
Antibody [Unconjugate ...
AF2894
Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]
Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
STAT3 Antibody
(232209) [Unconjugate
MAB1799
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
Western Blot STAT3 Antibody (232209) [Unconjugated]
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Jak3 Antibody
(5H2) - BSA Free
NBP2-37737
Western Blot Jak3 Antibody (5H2) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak3 Antibody (5H2) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak3 Antibody (5H2) - BSA Free
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
SOAT1 Antibody
NB400-141
SOAT1 Antibody
(7 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(672 Publications)
Species: Mu
Applications: ELISA
Tyk2 Antibody
(307214) [Unconjugate
MAB3427
Western Blot Tyk2 Antibody (307214) [Unconjugated]
(1 Review)
Species: Hu
Applications: WB
STAT5b Antibody
[Unconjugated]
AF1584
Simple Western STAT5b Antibody [Unconjugated]
Knockout Validated STAT5b Antibody [Unconjugated]
Immunocytochemistry STAT5b Antibody [Unconjugated]
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
STAT5a/b Antibody
[Unconjugated] - Pan ...
AF2168
Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific
Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific
Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific
(28 Publications)
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(455 Publications)
Species: Hu
Applications: BA
STAT2 [p Tyr690]
Antibody (1021D) [Unc ...
MAB2890
Simple Western STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]
Western Blot STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]
Western Blot STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]
(3 Publications)
Species: Hu
Applications: Simple Western, WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
gp130/CD130 [HRP]
DGP00
N/A gp130/CD130 [HRP]
N/A gp130/CD130 [HRP]
N/A gp130/CD130 [HRP]
(14 Publications)
Species: Hu
Applications: ELISA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
STAT6 Antibody
(177C322.1) - BSA Fre
NBP2-25241
Immunocytochemistry/ Immunofluorescence STAT6 Antibody (177C322.1) - BSA Free
Western Blot STAT6 Antibody (177C322.1) - BSA Free
Immunocytochemistry/ Immunofluorescence STAT6 Antibody (177C322.1) - BSA Free
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
SOCS-1 Antibody
NB100-56637
Western Blot SOCS-1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA

Publications for Jak1 Partial Recombinant Protein (H00003716-Q01)(1)


Reviews for Jak1 Partial Recombinant Protein (H00003716-Q01) (0)

There are no reviews for Jak1 Partial Recombinant Protein (H00003716-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Jak1 Partial Recombinant Protein (H00003716-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Jak1 Products

Research Areas for Jak1 Partial Recombinant Protein (H00003716-Q01)

Find related products by research area.

Blogs on Jak1.

Check out the latest blog posts on Jak1.
Signal Transducer and Activator of Transcription STAT6: More than a Player in Allergic Inflammation
By Jamshed Arslan, Pharm. D., PhD. What is STAT6?The cellular pathway comprising tyrosine kinase Janus Kinase (JAK) and the transcription factor STAT connect extracellular signals from various cytokines, hormones an...  Read full blog post.
Using a STAT3 antibody in chromatin immunoprecipitation (ChIP)
Signal transducer and activator of transcription 3 (STAT3) is an important oncogenic transcriptional factor that mediates tumor induced immune suppression.  Specifically, STAT3 transmits signals from cytokines and growth factor receptors in the pla...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, K562 human chronic myelogenous leukemia cell line, A20 mouse B cell lymphoma cell line, and L1.2 mouse pro-B cell line. PVDF membrane was probed with 1 µg/mL of Rat Anti-Human/Mouse/Rat Jak1 Monoclonal Antibody (Catalog # MAB4260) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for Jak1 at approximately 130 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Jak1 Antibody (413104) [Unconjugated]
MAB4260

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Jak1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol JAK1