Home » GFI1B » GFI1B Antibodies » GFI1B Antibody
Novus Biologicals products are now on bio-techne.com

GFI1B Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: GFI1B Antibody [NBP2-84040] - WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate
Western Blot: GFI1B Antibody [NBP2-84040] - WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate
Immunohistochemistry-Paraffin: GFI1B Antibody [NBP2-84040] - Rabbit Anti-GFI1B Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule and renal corpuscle. Antibody ...read more
Western Blot: GFI1B Antibody [NBP2-84040] - Host: Rabbit. Target: GFI1B. Positive control (+): Mouse testis (M-TE). Negative control (-): Rat liver (R-LI). Antibody concentration: 1ug/ml
Immunohistochemistry-Paraffin: GFI1B Antibody [NBP2-84040] - Rabbit Anti-GFI1B Antibody. Paraffin Embedded Tissue: Human Heart. Cellular Data: Myocardial cells. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GFI1B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GFI1B. Peptide sequence: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GFI1B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for GFI1B Antibody

  • growth factor independent 1B transcription repressor
  • Growth factor independent protein 1B
  • Potential regulator of CDKN1A translocated in CML
  • translocated inCML)
  • zinc finger protein Gfi-1b

Background

The GFI1B gene codes for a zinc finger protein Gfi-1b. Isoform 1 (p37) is 330 amino acids in length at around 37 kDA while isoform 2 (p32) is 284 amino acids long at approximately 32 kDA. GFI1B is essential in transcriptional regulation which is critical for the development and differentiation of erythroid and magakaryocytic lineages. Research is investigating the role of GFI1B in aplastic anemia, ataxia, chronic leukemia, anemia, neutropenia, and hematopoiesis. This gene has interacted with JAG2, BRE, LTBP4, EFEMP1, and EFEMP2 to contribute to pathways of lymphocyte signaling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GFI-1 Antibody
[Unconjugated]
AF3540
Intracellular Staining by Flow Cytometry GFI-1 Antibody [Unconjugated]
Western Blot GFI-1 Antibody [Unconjugated]
Western Blot GFI-1 Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
GATA-1 Antibody
(4F5) - BSA Free
NBP1-47492
Immunohistochemistry GATA-1 Antibody (4F5) - BSA Free
Immunocytochemistry/ Immunofluorescence GATA-1 Antibody (4F5) - BSA Free
Immunohistochemistry-Paraffin GATA-1 Antibody (4F5) - BSA Free
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
SCL/Tal1 Antibody
(OTI5H1)
NBP2-01488
Western Blot SCL/Tal1 Antibody (OTI5H1)
Flow Cytometry SCL/Tal1 Antibody (OTI5H1)
Immunocytochemistry/ Immunofluorescence SCL/Tal1 Antibody (OTI5H1)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
LSD1 Antibody
(1B2E5)
NB100-1762
Western Blot LSD1 Antibody (1B2E5)
Western Blot LSD1 Antibody (1B2E5)
Immunohistochemistry-Paraffin LSD1 Antibody (1B2E5)
(12 Publications)
Species: Hu, Mu, Pm
Applications: ChIP, ELISA, IHC, IHC-P, KD, Simple Western, WB
ZFPM1 Antibody
NBP2-47572
Immunocytochemistry/ Immunofluorescence ZFPM1 Antibody
Immunohistochemistry-Paraffin ZFPM1 Antibody
Immunohistochemistry-Paraffin ZFPM1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SCLY Antibody
NBP2-48693
Immunohistochemistry-Paraffin SCLY Antibody
Immunocytochemistry/ Immunofluorescence SCLY Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Fucosyltransferase
1/FUT1 Antibody
NBP3-35576
Western Blot Fucosyltransferase 1/FUT1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, WB
Cytokeratin 7
Antibody (OV-TL12/30) ...
NBP2-47940
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Flow Cytometry Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Kv11.1 Antibody -
Azide and BSA Free
NBP3-03109
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Kv11.1 Antibody - Azide and BSA Free
Western Blot Kv11.1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Ikaros/IKZF1
Antibody [Unconjugate
AF4984
Western Blot Ikaros/IKZF1 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) Ikaros/IKZF1 Antibody [Unconjugated]
Simple Western Ikaros/IKZF1 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
ERG Antibody - BSA
Free
NBP2-60655
Immunocytochemistry/ Immunofluorescence ERG Antibody - BSA Free
Western Blot ERG Antibody - BSA Free
Immunohistochemistry-Paraffin ERG Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CISH/CIS-1
Antibody [Unconjugate
AF3194
Western Blot CISH/CIS-1 Antibody [Unconjugated]
Immunocytochemistry CISH/CIS-1 Antibody [Unconjugated]
Simple Western CISH/CIS-1 Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
CBFA2T3 Antibody
NBP2-57636
Western Blot CBFA2T3 Antibody
Immunohistochemistry-Paraffin CBFA2T3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
RCOR1/CoREST
Antibody (9B3R7)
NBP3-16225
Immunohistochemistry-Paraffin RCOR1/CoREST Antibody (9B3R7)
Immunohistochemistry-Paraffin RCOR1/CoREST Antibody (9B3R7)
Immunohistochemistry-Paraffin RCOR1/CoREST Antibody (9B3R7)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, IP, WB
SOCS-1 Antibody
NB100-56637
Western Blot SOCS-1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu
Applications: WB
NPM1 Antibody -
BSA Free
NB110-61646
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence NPM1 Antibody - BSA Free
Western Blot NPM1 Antibody - BSA Free
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Slug Antibody
(OTI1A6)
NBP2-03886
Flow Cytometry Slug Antibody (OTI1A6)
Western Blot Slug Antibody (OTI1A6)
Immunohistochemistry-Paraffin Slug Antibody (OTI1A6)
(1 Review)
(10 Publications)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
GFI1B Antibody
NBP2-84040
GFI1B Antibody
Species: Hu
Applications: WB, IHC

Publications for GFI1B Antibody (NBP2-84040) (0)

There are no publications for GFI1B Antibody (NBP2-84040).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFI1B Antibody (NBP2-84040) (0)

There are no reviews for GFI1B Antibody (NBP2-84040). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GFI1B Antibody (NBP2-84040) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GFI1B Products

Array NBP2-84040

Research Areas for GFI1B Antibody (NBP2-84040)

Find related products by research area.

Blogs on GFI1B

There are no specific blogs for GFI1B, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GFI1B Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol GFI1B