![Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Analysis in human heart muscle and liver tissues. Corresponding FHL2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/FHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-84978-img0017.jpg "Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Analysis in human heart muscle and liver tissues. Corresponding FHL2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FHL2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for FHL2 Antibody (NBP1-84978)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FHL2 |
![Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human cerebellum, heart muscle, liver and skeletal muscle using Anti-FHL2 antibody NBP1-84978 (A) shows similar protein distribution across tissues to independent antibody NBP1-84979 (B).](http://images.novusbio.com/fullsize/FHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-84978-img0020.jpg "Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human cerebellum, heart muscle, liver and skeletal muscle using Anti-FHL2 antibody NBP1-84978 (A) shows similar protein distribution across tissues to independent antibody NBP1-84979 (B).")
![Western Blot: FHL2 Antibody [NBP1-84978] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/FHL2-Antibody-Western-Blot-NBP1-84978-img0007.jpg "Western Blot: FHL2 Antibody [NBP1-84978] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry/Immunofluorescence: FHL2 Antibody [NBP1-84978] - Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments & focal adhesion sites.](http://images.novusbio.com/fullsize/FHL2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84978-img0009.jpg "Immunocytochemistry/Immunofluorescence: FHL2 Antibody [NBP1-84978] - Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments & focal adhesion sites.")
![Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human skeletal muscle shows low positivity in myocytes as expected.](http://images.novusbio.com/fullsize/FHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-84978-img0023.jpg "Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human skeletal muscle shows low positivity in myocytes as expected.")
![Western Blot: FHL2 Antibody [NBP1-84978] - Analysis in human cell line U-2 OS.](http://images.novusbio.com/fullsize/FHL2-Antibody-Western-Blot-NBP1-84978-img0006.jpg "Western Blot: FHL2 Antibody [NBP1-84978] - Analysis in human cell line U-2 OS.")
![Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human cerebellum shows low positivity as expected.](http://images.novusbio.com/fullsize/FHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-84978-img0018.jpg "Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human cerebellum shows low positivity as expected.")
![Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human heart muscle shows strong cytoplasmic and nuclear positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/FHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-84978-img0021.jpg "Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human heart muscle shows strong cytoplasmic and nuclear positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human liver shows low positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/FHL2-Antibody-Immunohistochemistry-Paraffin-NBP1-84978-img0022.jpg "Immunohistochemistry-Paraffin: FHL2 Antibody [NBP1-84978] - Staining of human liver shows low positivity in hepatocytes as expected.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")