![Western Blot: Zinc finger protein 395 Antibody [NBP3-17459] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil](http://images.novusbio.com/fullsize/Zinc-finger-protein-395-Antibody-Western-Blot-NBP3-17459-img0003.jpg "Western Blot: Zinc finger protein 395 Antibody [NBP3-17459] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA |
| Predicted Species | Mouse (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF395 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Zinc finger protein 395 Antibody (NBP3-17459)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF395 |
![Immunocytochemistry/Immunofluorescence: Zinc finger protein 395 Antibody [NBP3-17459] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.](http://images.novusbio.com/fullsize/Zinc-finger-protein-395-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-17459-img0001.jpg "Immunocytochemistry/Immunofluorescence: Zinc finger protein 395 Antibody [NBP3-17459] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.")
![Immunohistochemistry-Paraffin: Zinc finger protein 395 Antibody [NBP3-17459] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Zinc-finger-protein-395-Antibody-Immunohistochemistry-Paraffin-NBP3-17459-img0002.jpg "Immunohistochemistry-Paraffin: Zinc finger protein 395 Antibody [NBP3-17459] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.")
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Western_Blot_5911.jpg)
![Simple Western XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Simple_Western_16640.jpg)
![Knockout Validated XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Knockout_Validated_22488.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")