![Western Blot: STX11 Antibody [NBP1-86122] - Analysis in human cell line HDLM-2.](http://images.novusbio.com/fullsize/STX11-Antibody-Western-Blot-NBP1-86122-img0006.jpg "Western Blot: STX11 Antibody [NBP1-86122] - Analysis in human cell line HDLM-2.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DIVFETDHILESLYRDIRDIQDENQLLVADVKRLGKQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMKELSEAAEAQHGPHSAVARISRAQYNALTLTFQRAMHDYNQAEMKQRDNCKIRIQRQLEIMGKEVSGDQIEDM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STX11 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 26176172). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Epimorphin/Syntaxin 2 Antibody (338930) [Unconjugated]](https://images.novusbio.com/images2/Epimorphin_MAB2568_Immunohistochemistry_6977.jpg)
| Publication using NBP1-86122 | Applications | Species |
|---|---|---|
| Yoshida N, Tsuzuki S, Karube K et al. STX11 functions as a novel tumor suppressor gene in peripheral T-cell lymphomas. Cancer Sci 2015-10-01 [PMID: 26176172] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STX11 |
![Immunohistochemistry-Paraffin: STX11 Antibody [NBP1-86122] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.](http://images.novusbio.com/fullsize/STX11-Antibody-Immunohistochemistry-Paraffin-NBP1-86122-img0002.jpg "Immunohistochemistry-Paraffin: STX11 Antibody [NBP1-86122] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.")
![Western Blot: STX11 Antibody [NBP1-86122] - Analysis in control (vector only transfected HEK293T lysate) and STX11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/STX11-Antibody-Western-Blot-NBP1-86122-img0007.jpg "Western Blot: STX11 Antibody [NBP1-86122] - Analysis in control (vector only transfected HEK293T lysate) and STX11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Western Blot XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Western_Blot_5911.jpg)
![Simple Western XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Simple_Western_16640.jpg)
![Knockout Validated XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Knockout_Validated_22488.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot VAMP-8 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP-8_AF5354_Western_Blot_5695.jpg)
![Immunohistochemistry VAMP-8 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP8_AF5354_Immunohistochemistry_19693.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")