![Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Analysis in human skeletal muscle and liver tissues. Corresponding TTN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Titin-Antibody-Immunohistochemistry-Paraffin-NBP1-88071-img0010.jpg "Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Analysis in human skeletal muscle and liver tissues. Corresponding TTN RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT |
| Predicted Species | Mouse (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TTN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P,HIER pH6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Titin Antibody (NBP1-88071)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TTN |
![Immunocytochemistry/Immunofluorescence: Titin Antibody [NBP1-88071] - SMYD2 Cys13 glutathionylation or oxidation reduces myofibril integrity. Monitoring the myofibril alignment in rat neonatal cardiomyocytes upon incubation of AMA (2 ug/mL) for 12 h: no expression of SMYD2 WT. Immunostainings were done by using antibodies to SMYD2, HA (green), or titin (alpha-titin-NT, red). About 30 cells were photographed and examined for myofibril alignment or directionality by FiberFit software. 34 Images represent the major myofibril structure in individual conditions. Scale bars, 10 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-018-06786-x), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Titin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88071-img0015.jpg "Immunocytochemistry/Immunofluorescence: Titin Antibody [NBP1-88071] - SMYD2 Cys13 glutathionylation or oxidation reduces myofibril integrity. Monitoring the myofibril alignment in rat neonatal cardiomyocytes upon incubation of AMA (2 ug/mL) for 12 h: no expression of SMYD2 WT. Immunostainings were done by using antibodies to SMYD2, HA (green), or titin (alpha-titin-NT, red). About 30 cells were photographed and examined for myofibril alignment or directionality by FiberFit software. 34 Images represent the major myofibril structure in individual conditions. Scale bars, 10 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-018-06786-x), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/Titin-Antibody-Immunohistochemistry-Paraffin-NBP1-88071-img0014.jpg "Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human fallopian tube shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Titin-Antibody-Immunohistochemistry-Paraffin-NBP1-88071-img0011.jpg "Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human fallopian tube shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/Titin-Antibody-Immunohistochemistry-Paraffin-NBP1-88071-img0012.jpg "Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Titin-Antibody-Immunohistochemistry-Paraffin-NBP1-88071-img0013.jpg "Immunohistochemistry-Paraffin: Titin Antibody [NBP1-88071] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunocytochemistry/ Immunofluorescence: Titin Antibody [NBP1-88071] - SMYD2 Cys13 glutathionylation or oxidation reduces myofibril integrity. a, b Monitoring the myofibril alignment in rat neonatal cardiomyocytes upon incubation of AMA (2 µg/mL) for 12 h: no expression (a) & ectopic expression of SMYD2 WT or C13S (b). Immunostainings were done by using antibodies to SMYD2, HA (green), or titin ( alpha -titin-NT, red). About 30 cells were photographed & examined for myofibril alignment or directionality by FiberFit software.34 Images represent the major myofibril structure in individual conditions. Scale bars, 10 µm. c Analysis of myofibril alignment in cardiomyocytes. Individual cell images were analyzed by the FiberFit software to determine the fiber dispersion parameter (k) values that represent the degree of fiber alignment. High k values represent the aligned networks, whereas low k values represent the disordered networks. The median values with 95% CI are shown, n = 3 independent experiments. Difference is significant by one-way ANOVA, followed by Tukey’s post-hoc test, *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001 Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30337525), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88071_rabbit-polyclonal-titin-antibody-310202416121981.jpg "Immunocytochemistry/ Immunofluorescence: Titin Antibody [NBP1-88071] - SMYD2 Cys13 glutathionylation or oxidation reduces myofibril integrity. a, b Monitoring the myofibril alignment in rat neonatal cardiomyocytes upon incubation of AMA (2 µg/mL) for 12 h: no expression (a) & ectopic expression of SMYD2 WT or C13S (b). Immunostainings were done by using antibodies to SMYD2, HA (green), or titin ( alpha -titin-NT, red). About 30 cells were photographed & examined for myofibril alignment or directionality by FiberFit software.34 Images represent the major myofibril structure in individual conditions. Scale bars, 10 µm. c Analysis of myofibril alignment in cardiomyocytes. Individual cell images were analyzed by the FiberFit software to determine the fiber dispersion parameter (k) values that represent the degree of fiber alignment. High k values represent the aligned networks, whereas low k values represent the disordered networks. The median values with 95% CI are shown, n = 3 independent experiments. Difference is significant by one-way ANOVA, followed by Tukey’s post-hoc test, *p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001 Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30337525), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: Titin Antibody [NBP1-88071] - SMYD2 Cys13 glutathionylation induces dissociation of SMYD2 from N2A & Hsp90. a, b SMYD2 glutathionylation disrupts its interaction with Hsp90. Purified SMYD2-SH & SMYD2-SSG were incubated with GST-Hsp90 bound to glutathione beads, & eluted sample was analyzed (a). Hsp90 was co-immunoprecipitated with SMYD2 WT or C13S from HEK293 cells in response to AMA with glucose deprivation (b). c, d SMYD2 glutathionylation disrupts its interaction with N2A. Purified SMYD2-SH & SMYD2-SSG were incubated with GST-N2A bound to glutathione beads, & eluted sample was analyzed (c). FLAG-N2A was co-immunoprecipitated with SMYD2 WT or C13S in HEK293 cells in response to AMA with glucose deprivation (d). e SMYD2 subjected to glutathionylation decreases its binding with N2A. SMYD2 WT or C13S was pre-incubated with H2O2 in the absence or presence of glutathione for 15 min, then mixed with GST-N2A bound to glutathione beads for 1 h. Eluted samples were analyzed. f, g Colocalization of titin & SMYD2 decreases upon incubation of AMA in rat neonatal cardiomyocytes expressing SMYD2 WT versus C13S. Immunostainings of cardiomyocytes with antibodies to titin ( alpha -titin-NT, red), HA, or SMYD2 (green) are shown with enlarged areas for details (the red boxes) (f). Pearson’s correlation coefficients were calculated to determine colocalization of titin & SMYD2 (g). About 30 cells were analyzed in individual conditions. Images represent the major colocalization pattern in individual experiments. Scale bars, 10 µm. Data represent the mean ± SD, n = 3 independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30337525), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88071_rabbit-polyclonal-titin-antibody-310202416114738.jpg "Immunocytochemistry/ Immunofluorescence: Titin Antibody [NBP1-88071] - SMYD2 Cys13 glutathionylation induces dissociation of SMYD2 from N2A & Hsp90. a, b SMYD2 glutathionylation disrupts its interaction with Hsp90. Purified SMYD2-SH & SMYD2-SSG were incubated with GST-Hsp90 bound to glutathione beads, & eluted sample was analyzed (a). Hsp90 was co-immunoprecipitated with SMYD2 WT or C13S from HEK293 cells in response to AMA with glucose deprivation (b). c, d SMYD2 glutathionylation disrupts its interaction with N2A. Purified SMYD2-SH & SMYD2-SSG were incubated with GST-N2A bound to glutathione beads, & eluted sample was analyzed (c). FLAG-N2A was co-immunoprecipitated with SMYD2 WT or C13S in HEK293 cells in response to AMA with glucose deprivation (d). e SMYD2 subjected to glutathionylation decreases its binding with N2A. SMYD2 WT or C13S was pre-incubated with H2O2 in the absence or presence of glutathione for 15 min, then mixed with GST-N2A bound to glutathione beads for 1 h. Eluted samples were analyzed. f, g Colocalization of titin & SMYD2 decreases upon incubation of AMA in rat neonatal cardiomyocytes expressing SMYD2 WT versus C13S. Immunostainings of cardiomyocytes with antibodies to titin ( alpha -titin-NT, red), HA, or SMYD2 (green) are shown with enlarged areas for details (the red boxes) (f). Pearson’s correlation coefficients were calculated to determine colocalization of titin & SMYD2 (g). About 30 cells were analyzed in individual conditions. Images represent the major colocalization pattern in individual experiments. Scale bars, 10 µm. Data represent the mean ± SD, n = 3 independent experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30337525), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_10689.jpg)
![Immunohistochemistry Desmin Antibody [Unconjugated]](https://images.novusbio.com/images2/Desmin_AF3844_Immunohistochemistry_6808.jpg)
![Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]](https://images.novusbio.com/images/af3844_human-mouse-desmin-affinity-purified-polyclonal-ab-41202410331920.jpg)
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![Simple Western Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Simple_Western_17259.jpg)
![Western Blot Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Western_Blot_14481.jpg)
![Immunohistochemistry Gelsolin/GSN Antibody (893205) [Unconjugated]](https://images.novusbio.com/images2/Gelsolin_MAB8170_Immunohistochemistry_14553.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")