Novus Biologicals products are now on bio-techne.com

eIF4B Recombinant Protein Antigen

Name: eIF4B Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-33284PEP
Price: 279 USD

Images

There are currently no images for eIF4B Protein (NBP2-33284PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

eIF4B Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF4B. Source: E. coli Amino Acid Sequence: TTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	EIF4B
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33284. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for eIF4B Recombinant Protein Antigen

Eif4a2
eIF4B
EIF-4B
eukaryotic translation initiation factor 4B
PRO1843

Background

Eukaryotic initiation factor 4B (eIF4B) is a factor required for the binding of mRNA to ribosomes for the initiation of translation. eIF4B has been demonstrated to modulate the helicase activity of eIF4A, a component of the eIF4F complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

eIF4A1 Antibody

NBP2-24632

Immunohistochemistry-Paraffin eIF4A1 Antibody

(2 Publications)

Species: Ca, Ch, Hu, Mu, Pm, Rt

Applications: IHC, IHC-P, WB

eIF4A2 Antibody

NBP2-24529

Immunohistochemistry-Paraffin eIF4A2 Antibody

(1 Review)

(1 Publication)

Species: Ca, Ch, Hu, Mu, Pm

Applications: IHC, IHC-P, Simple Western, WB

eIF4G1 Antibody

NB100-268

(26 Publications)

Species: Hu, Po

Applications: IP, WB

eIF4E [p Ser209]
Antibody

NB100-81898

Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody

Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody

(1 Publication)

Species: Hu, Po

Applications: ICC/IF, IHC, IHC-P, WB

Ribosomal Protein
S6/RPS6 Antibody

NB100-1595

Western Blot Ribosomal Protein S6/RPS6 Antibody

Immunoprecipitation Ribosomal Protein S6/RPS6 Antibody

(1 Review)

(6 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

TOR/mTOR [p
Ser2448] Antibody

NB600-607

Western Blot TOR/mTOR [p Ser2448] Antibody

(2 Reviews)

(9 Publications)

Species: Hu, Rt

Applications: ELISA, IHC, IHC-P, WB

eIF2 alpha/EIF2S1
Antibody (OTI3H4)

NBP2-02669

Western Blot eIF2 alpha/EIF2S1 Antibody (OTI3H4)

Immunohistochemistry-Paraffin eIF2 alpha/EIF2S1 Antibody (OTI3H4)

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Tbp7 Antibody

NBP1-87799

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

4EBP1 Antibody

NB200-157

(45 Publications)

Species: Hu

Applications: IHC, IHC-P, KO, WB

eIF4H Antibody

NBP1-83057

Immunohistochemistry-Paraffin eIF4H Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

RSK1 [p Ser380]
Antibody (1024A) [Unc ...

MAB79671

Simple Western RSK1 [p Ser380] Antibody (1024A) [Unconjugated]

Western Blot RSK1 [p Ser380] Antibody (1024A) [Unconjugated]

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC, Simple Western, WB

Eukaryotic
translation initiatio ...

NBP2-00702

Species: Hu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

PABP Antibody
(10E10) - BSA Free

NB120-6125

Western Blot PABP Antibody (10E10) - BSA Free

(1 Review)

(11 Publications)

Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB

AKT [p Ser473]
Antibody [Unconjugate ...

AF887

Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

(49 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

EIF1A Antibody

NBP1-85808

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

eEF-2 Antibody
(4E2Z5)

NBP3-16866

Immunocytochemistry/ Immunofluorescence eEF-2 Antibody (4E2Z5)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

PIK3CA Antibody

NBP2-19804

Immunohistochemistry-Paraffin PIK3CA Antibody

(4 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

p21/CIP1/CDKN1A
Antibody (WA-1)

NBP2-29463

(24 Publications)

Species: Pm, Hu, Pm, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

eIF4B Recombinant
Protein Antigen

NBP2-33284PEP

Species: Hu

Applications: AC

Publications for eIF4B Protein (NBP2-33284PEP) (0)

There are no publications for eIF4B Protein (NBP2-33284PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4B Protein (NBP2-33284PEP) (0)

There are no reviews for eIF4B Protein (NBP2-33284PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for eIF4B Protein (NBP2-33284PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF4B Products

Research Areas for eIF4B Protein (NBP2-33284PEP)

Find related products by research area.

Blogs on eIF4B

There are no specific blogs for eIF4B, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our eIF4B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

EIF4B

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

eIF4B Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

eIF4B Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for eIF4B Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for eIF4B Protein (NBP2-33284PEP) (0)

Reviews for eIF4B Protein (NBP2-33284PEP) (0)

FAQs for eIF4B Protein (NBP2-33284PEP) (0)

Additional eIF4B Products

Research Areas for eIF4B Protein (NBP2-33284PEP)

Blogs on eIF4B

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics