![Western Blot: BDNF Antibody [NBP1-59304] - ANT-DBS inhibited BDNF-TrkB pathway and its downstream regulator in the hippocampus of epileptic monkeys. Analysis of BDNF (1:1000, NBP1-59304), TrkB (1:500, NPB1-47898), p-ERK, ERK, p-Akt, Akt, p-S6K and S6K by western blotting. Image collected and cropped by CiteAb from the following publication (www.aging-us.com/lookup/doi/10.18632/aging.103026) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/BDNF-Antibody-Western-Blot-NBP1-59304-img0009.jpg "Western Blot: BDNF Antibody [NBP1-59304] - ANT-DBS inhibited BDNF-TrkB pathway and its downstream regulator in the hippocampus of epileptic monkeys. Analysis of BDNF (1:1000, NBP1-59304), TrkB (1:500, NPB1-47898), p-ERK, ERK, p-Akt, Akt, p-S6K and S6K by western blotting. Image collected and cropped by CiteAb from the following publication (www.aging-us.com/lookup/doi/10.18632/aging.103026) licensed under a CC-BY license.")
| Reactivity | Hu, Mu, Pm, RMSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to BDNF(brain-derived neurotrophic factor) The peptide sequence was selected from the middle region of BDNF. Peptide sequence EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BDNF |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID:31849603). |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Immunohistochemistry_10167.jpg)
![Western Blot TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Western_Blot_23433.jpg)
![Western Blot TrkB Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkB_AF1494_Western_Blot_19007.jpg)
| Publications using NBP1-59304 | Applications | Species |
|---|---|---|
| Ediga PK, Phadtare CV A Study on Regulation of HDAC1 2 Activity by Ube3a Implication in Angelman Syndrome Conference 2023-01-01 | ||
| Du T T, Zhu G et al. Anterior thalamic nucleus stimulation protects hippocampal neurons by activating autophagy in epileptic monkeys. Aging (Albany NY) 2020-08-04 [PMID: 32267832] (WB, Rhesus Macaque) | WB | Rhesus Macaque |
| Kumar V, Joshi T, Vatsa N, et al. Simvastatin Restores HDAC1/2 Activity and Improves Behavioral Deficits in Angelman Syndrome Model Mouse Front Mol Neurosci 2019-11-26 [PMID: 31849603] (ICC/IF, Mouse) | ICC/IF | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for BDNF Antibody (NBP1-59304)Find related products by research area.
|
|
Read full blog post. |
|
The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura. It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol... Read full blog post. |
|
The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2 Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain. Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa). The importance of t... Read full blog post. |
|
Niemann Pick-C1 and cholesterol dynamics Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis. Although cholesterol moves freely inside the cell, it cannot independently expo... Read full blog post. |
|
Synapsin I: Implicated in synaptic activity across a diverse range of studies Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal. Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i... Read full blog post. |
|
TrkB: Bridging Ontogenesis and Oncogenesis Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. Interaction of brain-derived neurotrophic factor (BDNF) with its ... Read full blog post. |
|
TrkB and Nervous System Function Neutrophins and their receptors play an important role in regulating the development of both the central and peripheral nervous systems. Neurotrophin ligand binding to each of their respective Trk cellular receptors is essential for the growth and sur... Read full blog post. |
|
TrkB: Docking for Neurotrophins and Beyond. Tropomyosin receptor kinase B (TrkB) is a member of the Trk receptor tyrosine kinases family consisting of TrkA, TrkB and TrkC. The sequence of these family members is highly conserved. TrK's are activated by several neurotrophins, which are small pro... Read full blog post. |
|
BDNF Antibodies Aid Research on Alzheimer's Therapies Brain-derived neurotrophic factor (BDNF) is known to be important for neuronal differentiation, survival, migration and plasticity in both the developing embryo and adult synapses. The BDNF antibody is also proving to be an important tool in Alzheimer... Read full blog post. |
|
BDNF Antibodies and Synaptic Research Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophins. During development it regulates the survival and differentiation of neuronal cell populations in the central and peripheral nervous system, while in adult synapse... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: BDNF Antibody [NBP1-59304] - Ventral horn region of mouse spinal cord. Concentration 1:200](http://images.novusbio.com/fullsize/BDNF-Antibody-Immunohistochemistry-NBP1-59304-img0004.jpg "Immunohistochemistry: BDNF Antibody [NBP1-59304] - Ventral horn region of mouse spinal cord. Concentration 1:200")
![Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates.](http://images.novusbio.com/fullsize/BDNF-Antibody-Western-Blot-NBP1-59304-img0005.jpg "Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates.")
![Western Blot: BDNF Antibody [NBP1-59304] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/BDNF-Antibody-Western-Blot-NBP1-59304-img0002.jpg "Western Blot: BDNF Antibody [NBP1-59304] - Human Liver cell lysate, concentration 0.2-1 ug/ml.")
![Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates, Antibody Dilution: 1 ug/ml.](http://images.novusbio.com/fullsize/BDNF-Antibody-Western-Blot-NBP1-59304-img0006.jpg "Western Blot: BDNF Antibody [NBP1-59304] - ACHN Whole Cell lysates, Antibody Dilution: 1 ug/ml.")
![Western Blot: BDNF Antibody [NBP1-59304] - Fetal Liver lysates, Antibody Dilution: 0.5 ug/ml.](http://images.novusbio.com/fullsize/BDNF-Antibody-Western-Blot-NBP1-59304-img0007.jpg "Western Blot: BDNF Antibody [NBP1-59304] - Fetal Liver lysates, Antibody Dilution: 0.5 ug/ml.")
![Western Blot: BDNF Antibody [NBP1-59304] - Sample Tissue: Human ACHN Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/BDNF-Antibody-Western-Blot-NBP1-59304-img0008.jpg "Western Blot: BDNF Antibody [NBP1-59304] - Sample Tissue: Human ACHN Antibody Dilution: 1.0 ug/ml")
![Immunohistochemistry: BDNF Antibody [NBP1-59304] - Rhesus macaque spinal cord. Concentration1:300.](http://images.novusbio.com/fullsize/BDNF-Antibody-Immunohistochemistry-NBP1-59304-img0003.jpg "Immunohistochemistry: BDNF Antibody [NBP1-59304] - Rhesus macaque spinal cord. Concentration1:300.")
![Western Blot: BDNF Antibody [NBP1-59304] - Simvastatin treatment increases BDNF expression in primary cortical neurons of AS mice. (A) Primary cultured cortical neurons prepared from wild type & AS embryos were treated with 5 μM simvastatin at DIV14 for 12 h. Neurons were then fixed & processed for double immunofluorescence staining using Ube3a & BDNF antibodies. Representative images were shown. About 12 immunostained neurons in each group were checked for BDNF expression, fluorescence intensity in each cell was quantified & compared. Scale bar, 50 μm. (B) Immunoblot analysis of matured BDNF levels in simvastatin treated primary cortical neurons as described above. (C) Band intensity of the mature BDNF was quantified & normalized to Tuj1 (BDNF/Tuj1). Values are mean ± SD; n = 3. The ‘a’ point P < 0.05 compared to vehicle treated wild type group & “b” denote P < 0.05 with respect to vehicle treated AS group (one way ANOVA with Holm–Sidak post hoc test). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31849603), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-59304_rabbit-polyclonal-bdnf-antibody-310202416182644.jpg "Western Blot: BDNF Antibody [NBP1-59304] - Simvastatin treatment increases BDNF expression in primary cortical neurons of AS mice. (A) Primary cultured cortical neurons prepared from wild type & AS embryos were treated with 5 μM simvastatin at DIV14 for 12 h. Neurons were then fixed & processed for double immunofluorescence staining using Ube3a & BDNF antibodies. Representative images were shown. About 12 immunostained neurons in each group were checked for BDNF expression, fluorescence intensity in each cell was quantified & compared. Scale bar, 50 μm. (B) Immunoblot analysis of matured BDNF levels in simvastatin treated primary cortical neurons as described above. (C) Band intensity of the mature BDNF was quantified & normalized to Tuj1 (BDNF/Tuj1). Values are mean ± SD; n = 3. The ‘a’ point P < 0.05 compared to vehicle treated wild type group & “b” denote P < 0.05 with respect to vehicle treated AS group (one way ANOVA with Holm–Sidak post hoc test). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31849603), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![NT-3 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "NT-3 [Unconjugated]")
![SDS-PAGE beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_321.jpg)
![Bioactivity beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_322.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Immunohistochemistry_6672.jpg)
![Western Blot TrkA Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkA_AF1056_Western_Blot_17300.jpg)
![Immunohistochemistry TrkA Antibody [Unconjugated]](https://images.novusbio.com/images/af1056_rat-trka-affinity-purified-polyclonal-ab-8220249503264.jpg)
![Immunohistochemistry NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Immunohistochemistry_6685.jpg)
![Western Blot NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Western_Blot_17941.jpg)
![Bioactivity GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212GD_2846.jpg)
![SDS-PAGE GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212-GD_62.jpg)
![SEC-MALS GDNF [Unconjugated]](https://images.novusbio.com/images/212-gd_recombinant-human-gdnf-protein-sec-mals-25202393740..jpg)
![Western Blot TrkC Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkC_AF1404_Western_Blot_19346.jpg)
![Simple Western TrkC Antibody [Unconjugated]](https://images.novusbio.com/images2/TrkC_AF1404_Simple_Western_20169.jpg)
![Immunocytochemistry/ Immunofluorescence TrkC Antibody [Unconjugated]](https://images.novusbio.com/images/af1404_mouse-rat-trkc-affinity-purified-polyclonal-ab-8220249503256.jpg)
![SDS-PAGE CNTF [Unconjugated]](https://images.novusbio.com/images2/CNTF_257-NT_502.jpg)
![Bioactivity CNTF [Unconjugated]](https://images.novusbio.com/images2/CNTF_257-NT_520.jpg)
![Western Blot LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12543.jpg)
![Immunocytochemistry LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12613.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/TNF_RII_DRT200_ELISA_176.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_817.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_818.jpg)
![Neutralization Siglec-7/CD328 Antibody [Unconjugated]](https://images.novusbio.com/images2/Siglec-7_AF1138_Block_Neutralize_8760.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")